KEGG   Acidovorax sp. JS42: Ajs_2208
Entry
Ajs_2208          CDS       T00455                                 
Name
(GenBank) conserved hypothetical protein
Organism
ajs  Acidovorax sp. JS42
SSDB
Motif
Pfam: TraG-D_C TrwB_AAD_bind DUF87 Clostridium_P47 Cpta_toxin
Other DBs
NCBI-ProteinID: ABM42373
Position
complement(2342331..2344487)
AA seq 718 aa
MAQPHAVEVLLRPAVELHTVAVCTGAAILCLVAPWSLALNPLLGLGSALAFLIFGAIRLR
DAWAILRYRRNIRRLPRYVMTSRDVPVSQQRLFVGRGFRWEQRHTHRLMQTYRPGFRRYV
EPTAIYRAARRLEERLEFAPFPVSTLARALAWDSPLNPARPLPPVGGLPRLHGIEPHEVD
VTLPLGERVGHSLVLGTTRVGKTRLAELFITQDIRRKVRGEHEVVIVFDPKGDADLLKRM
YVEAKRAGREGEFYVFHLGWPDISARYNAVGRFGRISEVATRIAGQLSGEGNSAAFREFA
WRFVNIIARALVELGQRPDYLLIQRHVINIDALFIEYAQHYFAKNEPKAWEVIVQLEGKL
NEKNIPRNMIGREKRVVALEQYLSQVRIYDPVLDGLRSAVRYDRTYFDKIVASLLPLLEK
LTTGKIAQLLAPNYSDLSDPRPIFDWMQVIRKRAVVYVGLDALSDAEVAAAVGNSMFSDL
VSVAGHIYKFGIDDGLPGAAVSAKIPINVHADEFNELMGDEFIPMVNKGGGAGVQVTAYT
QTLSDIEARIGNRAKAGQVVGNFNNLFMLRVRETATAELLTRQLPKVEVYATALMSGATD
SSDPHGNTAFTSNTQDRISTTSVPLIEPAHVVALPKGQCFALIEGGNLWKVRMPLPAPDP
DEAMPKDLQELAGYMRQHYVEAGDWWENQGIPGLQDKALPDDLLDDFKRMAAAEEAEA
NT seq 2157 nt   +upstreamnt  +downstreamnt
atggcccaaccgcatgcggtcgaggttctgctgcggccagcggtggagcttcataccgtg
gcggtctgcaccggcgccgcgattctgtgcctggtggcaccgtggtcgctcgcgctgaac
ccgctgctcggcctgggctcggcactggccttcctgatcttcggcgcgattcgcctgcgc
gatgcctgggcgatcctgcgctatcgccgcaacatccgccgcctgccgcgctacgtgatg
accagccgcgacgtgccggtgagccaacagcggctgttcgtcggccgaggctttcgctgg
gagcagcggcacacgcaccggctgatgcagacctaccggccggggttccgccgctatgtc
gagccgacggcgatctaccgggccgcccggcggctggaggagcggcttgagttcgcgccg
tttcccgtctcgacactggcgcgcgcgctggcctgggacagcccgctcaacccggcgcga
ccgctgccgccggtcggcggactgccacgcctgcatggcatcgagccgcacgaggtcgac
gtcacgctgccgctgggcgagcgcgtcggccactccctggtgctgggcaccacgcgcgtg
ggcaagacgcggctggccgagctgttcatcacccaggacatccgccgcaaggtccgcggc
gagcacgaggtggtgatcgtcttcgaccccaagggcgacgccgacctgttgaagcgcatg
tacgtcgaggccaagcgcgccgggcgcgaaggcgagttctacgtgttccatctgggctgg
cccgacatctcggcgcgctacaacgccgtgggccggttcgggcggatctccgaggtggcc
acgcgcatcgccggacagctctcgggcgagggcaacagcgcggcgttccgcgagttcgcc
tggcgcttcgtcaacatcatcgcgcgcgccctggtcgagctggggcagcgtccggactac
ctgctgatccagcgccacgtcatcaacatcgacgcgctgttcatcgagtacgcccagcac
tacttcgccaagaacgagccgaaggcctgggaggtcatcgtccagctcgaaggcaagctc
aacgagaagaacatcccgcgcaacatgatcgggcgcgagaagcgcgtggtggccctcgaa
cagtacctgtcccaggtgcgcatctatgacccggtgctcgacggcctgcgcagcgccgtg
cgctacgaccggacgtacttcgacaagatcgtcgcttcgctgctgccgctgctggagaag
ctcaccaccggcaagatcgcgcaactgctcgcaccgaactattccgacctgtccgacccg
cggccgatcttcgactggatgcaggtcatccgcaagcgcgcggtggtctacgtggggctg
gatgcgctgtccgacgccgaagtcgcggcagcggtgggcaactcgatgttcagcgacctg
gtctcggtggccggccacatctacaagttcggcatcgatgacgggctgcccggcgccgcg
gtgagcgccaagattccgatcaacgtccacgccgacgaattcaatgaactcatgggcgac
gagttcattccgatggtcaacaagggcggcggtgccggcgtacaggtgacggcctacacg
cagaccttgagcgacatcgaggcgcgcatcggcaaccgtgccaaggccggccaggtggtc
ggcaacttcaacaacctgttcatgctgcgcgtgcgcgagaccgccaccgccgagctgctg
acgcgacaactgcccaaggtcgaggtgtacgccacggcactgatgagcggcgccaccgac
agctccgacccgcacggcaataccgcgttcacgtccaacacgcaggaccgcatcagcacg
accagcgtgccgttgatcgagcccgcgcatgtggtggcgctaccgaaggggcagtgcttc
gcgctgatcgagggcggcaacctctggaaagtccgcatgccgctgccggcacccgacccc
gacgaagccatgccgaaggatctgcaggagctggccggctacatgcggcagcactacgtc
gaggcaggagactggtgggagaaccaaggcatccccggcctgcaggacaaggcgctgccc
gacgacctgctggacgacttcaagcggatggccgccgctgaagaggccgaagcatga

DBGET integrated database retrieval system