KEGG   Acidovorax sp. JS42: Ajs_2317Help
Entry
Ajs_2317          CDS       T00455                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ajs  Acidovorax sp. JS42
Pathway
ajs00071  Fatty acid degradation
ajs00072  Synthesis and degradation of ketone bodies
ajs00280  Valine, leucine and isoleucine degradation
ajs00310  Lysine degradation
ajs00362  Benzoate degradation
ajs00380  Tryptophan metabolism
ajs00620  Pyruvate metabolism
ajs00630  Glyoxylate and dicarboxylate metabolism
ajs00640  Propanoate metabolism
ajs00650  Butanoate metabolism
ajs00900  Terpenoid backbone biosynthesis
ajs01100  Metabolic pathways
ajs01110  Biosynthesis of secondary metabolites
ajs01120  Microbial metabolism in diverse environments
ajs01130  Biosynthesis of antibiotics
ajs01200  Carbon metabolism
ajs01212  Fatty acid metabolism
ajs02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ajs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Ajs_2317
   00630 Glyoxylate and dicarboxylate metabolism
    Ajs_2317
   00640 Propanoate metabolism
    Ajs_2317
   00650 Butanoate metabolism
    Ajs_2317
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Ajs_2317
   00072 Synthesis and degradation of ketone bodies
    Ajs_2317
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Ajs_2317
   00310 Lysine degradation
    Ajs_2317
   00380 Tryptophan metabolism
    Ajs_2317
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Ajs_2317
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Ajs_2317
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ajs_2317
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ajs04147]
    Ajs_2317
Enzymes [BR:ajs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Ajs_2317
Exosome [BR:ajs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Ajs_2317
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ABM42479
UniProt: A1W8A4
Position
complement(2457864..2459033)
Genome map
AA seq 389 aa AA seqDB search
MNAIPILAWARTPVAPVGGVLAACQPHDLAAPLVARMLADAGLPAEAVDAVVLGNALGAG
GNPARMLALAAGLPEGIPAVTLDSQCCAGLDAVTHACGLLALGQADVVVAGGAEAWSRAP
LRMHRPLQAEEAPVPYDRPPFTPWPARDPDMLLAALDGARRLGLTRHAQDAYAMASHARS
VAARAAMAHEIVPLRGLAHDAYPRLLSAARVARMPAVASGQSVDGQDCSLSTVAVSPKAD
GAALLLLATPSACARWGVRPRAQWRGSVSVGGAPESPMLCAVDVARAAQQRCGWDWAALE
ALELHDAFAAQGLAFCNALGLPLGAINRGGGGLARGHPIGASGAIALVRVLAQMAQRQGA
DRTDRTLRGMACIAGAGGLGAATWVEMPE
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgctattcccatattggcctgggcgcgcacgccggtggcgccggtcggcggggtg
ctcgcggcctgccagccgcacgatctggcggcgccgctggtggcgcgcatgctggcggat
gccgggttgccggccgaggccgtcgatgccgtggtgctgggcaacgccctgggcgccggg
ggcaaccccgcccgcatgctggcgctggcggccggcctccccgagggcattcccgccgtg
acgctggacagccagtgctgcgcggggctggatgccgtcacccatgcctgcggtctgctg
gcgctgggccaggccgatgtcgtggttgccggcggggccgaggcgtggagccgcgcaccc
ctgcgcatgcaccggcctctgcaggcggaggaggcaccggtgccctatgaccggccaccc
ttcacgccctggcccgcgcgcgaccccgacatgctgctggccgcgctggacggcgcgcgg
cgcctggggctcacgcgccacgcgcaggatgcgtacgccatggccagccacgcgcgcagc
gtggcggcgcgcgctgccatggcccatgaaatcgtgccgctgcgggggttggcgcacgac
gcctacccgcgcctgttgagcgccgcgcgtgtggcgcgcatgcctgcggtggccagcggt
caatcggtggacggccaggattgcagcctcagcaccgtcgccgtgtcgcccaaggcggac
ggcgcggccctgctgctgttggccacgccctcggcctgcgcgcgctggggcgtgcggccg
cgtgcgcagtggcgcggcagcgtcagcgtgggtggcgcgcccgagtcgcccatgctctgc
gccgtcgacgtggcacgcgccgcgcagcaacgctgtggctgggattgggcggcgctggag
gcgctggaactgcacgacgcctttgcggcgcagggcctggcgttctgcaatgcgctgggc
ttgccgctcggtgccatcaaccggggcgggggcggcctggcgcgcgggcaccccatcggt
gcatcgggcgccattgcgctggtgcgcgtgctggcgcagatggcgcagcggcagggtgcc
gatcgcaccgaccgcacgctgcgcggcatggcgtgcattgcgggtgcgggtggcctgggt
gcggccacctgggtggaaatgccggagtga

DBGET integrated database retrieval system