KEGG   Acidovorax sp. JS42: Ajs_2790Help
Entry
Ajs_2790          CDS       T00455                                 

Definition
(GenBank) Trans-aconitate 2-methyltransferase
  KO
K00598  trans-aconitate 2-methyltransferase [EC:2.1.1.144]
Organism
ajs  Acidovorax sp. JS42
Brite
KEGG Orthology (KO) [BR:ajs00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Ajs_2790
Enzymes [BR:ajs01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.144  trans-aconitate 2-methyltransferase
     Ajs_2790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_31 Methyltransf_11 Methyltransf_23 Methyltransf_12 MTS FtsJ Methyltransf_33 Methyltransf_5 Methyltransf_2 Methyltransf_32 Ubie_methyltran Methyltransf_4 Methyltransf_24 MetW RrnaAD
Motif
Other DBs
NCBI-ProteinID: ABM42931
UniProt: A1W9K6
Position
complement(2954087..2954863)
Genome map
AA seq 258 aa AA seqDB search
MHDWDPALYQRFESEHTRPAVELLARVSHPAPRHIVDLGCGNGNSTQLLLERFPQSQLIG
LDNSEAMLASARKRLPGVPFVQADIADWAPTVAPDLIFANASLQWVAGHAGLFARLMRCL
APGGVLAVQMPDNLDQPSHQLMRELASQSAWRDQLAHAADQRAALLSVEAYYDLLAPMAC
RVDIWHTAYRHVMPSVQAIVEWLESTGLKPFLDPLPAVLRDAYLQAYTQRIGEAYTKRAD
GHRLFAFPRLFIVAQRAP
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgcacgactgggatcccgcgctctaccagcgcttcgagagcgagcacacacgcccggct
gtcgagttgctggcgcgggtctcccatcccgcaccccgccacatcgtggacttgggctgc
gggaatggcaattccacgcaattgctgctggagcggttcccgcagtcgcaactcatcggt
ctggacaactccgaagcgatgctggccagtgcgcgcaagcgtttgcccggtgtgcccttc
gtgcaggccgacattgccgactgggcgcccaccgtggcgcccgatttgatttttgccaac
gcctccctgcagtgggtggcagggcatgccgggctgttcgcccggttgatgcgctgcctg
gcacccggcggtgtcctggcggtgcagatgcccgacaacctggaccagccgtcgcaccag
ctcatgcgcgagctggcgagccagtctgcgtggcgtgatcagctggcgcatgccgcggac
cagcgcgcggcactgttgtcggtggaggcttattacgaccttctcgcgcccatggcctgc
cgggtcgatatctggcacaccgcgtaccgccatgtcatgccttcggtccaggctatcgtt
gagtggctggagtccacaggcctgaaacccttccttgatccgctccccgccgtgttgcgg
gatgcgtatcttcaggcctacacgcagcgcattggcgaggcctataccaagcgcgcggac
ggccatcggctgttcgcctttccccgtttgttcatcgttgcccagcgtgccccatga

DBGET integrated database retrieval system