KEGG   Acidovorax sp. JS42: Ajs_2902Help
Entry
Ajs_2902          CDS       T00455                                 

Definition
(GenBank) conjugation TrbI family protein
  KO
K20533  type IV secretion system protein TrbI
Organism
ajs  Acidovorax sp. JS42
Pathway
ajs02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:ajs00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Ajs_2902
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ajs02044]
    Ajs_2902
Secretion system [BR:ajs02044]
 Type IV secretion system
  Trb secretion system protein
   Ajs_2902
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrbI
Motif
Other DBs
NCBI-ProteinID: ABM43043
UniProt: A1W9W8
Position
complement(3076590..3077852)
Genome map
AA seq 420 aa AA seqDB search
MSQDDSPDLAPQAGKVVPEAVALRAQPRPVTRLNRRTLVMLTGGLSVAVLGATIWSLQPH
RRAGEQTELYNVDRVSKSEGLDGLPSDYSKLPKVPELGPPLPGDLGPAIVKSQQPVAPTY
APPGHDPEDARRKEAEAAAASSVFFRSGTPGKTAAPATAQVGAAGQASALAGFDPLAAGP
ASTAAQPADPTAVQNRQDQKEAFLKGGSTETRNSGNLKMPSSPYQVMAGTVIAGALVTGI
KSDLPGDVIATVTEPVYDTATGKFLLIPQGSRILGKYNSQVSYGQSRVQVVWNRIILPDT
SSLTLDNLVGTDPAGYSGLEDGVDYHWSRIVAGAALTTLLGVGAELAAPENRQDGNRIII
AGRDSAQDSINQVGQEMTRRNMNIQPTLTERPGLPVRIIVNRDLVLRPYQPMFFQRGAMQ
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgagccaggacgattcccctgaccttgcaccgcaggcgggcaaggtcgtgcccgaggcg
gtggcgctgcgcgcccagccgcgcccggtcacacgcctgaaccggcgcacgctagtcatg
ctcaccggcggcctgtcggtcgccgtgctcggggccacgatctggtcattgcagccgcac
cggcgcgcgggtgagcagaccgagctgtacaacgtcgatcgcgtgtcgaagtccgaaggg
ctggatggcttgccttcggattactccaagctgccgaaggtgccggaactggggccgccg
ctgccgggcgaccttggcccggccatcgtgaagtcgcagcagcccgtggcgcccacctac
gcgccgccgggccacgacccggaggatgcacggcgcaaggaagctgaagcggcagcagct
tcctcggtgttcttccgctcgggcacgcctggcaagaccgccgcgccagcgactgcgcaa
gtcggtgcggctggccaagcatcggccttggcgggcttcgacccgctggccgccgggcca
gcctcgacggcggctcagcctgccgacccgaccgctgtgcaaaaccggcaagaccaaaaa
gaggcgttcctgaagggcggctctacggagacccgcaattccgggaatctgaaaatgccg
tcctcgccgtatcaggtgatggccgggacggtgatcgccggcgcgctggtgacgggcatc
aagtcggacttgccgggcgacgtgatcgccacggtgacggagccggtctatgacacggcc
acgggcaagttcctgctgattccgcagggctcgcgcatcctgggcaagtacaacagccag
gtgagctatgggcaaagccgggttcaggtggtttggaaccgcatcatcctgccggacacg
tcctcgctgacgctagacaacctcgtgggcaccgatccggccggctattccggcctggaa
gacggggtggactaccactggagccgcatcgtcgccggtgccgcgctgacgacgctgctg
ggcgtgggcgccgagctggccgcgccggagaaccggcaggacggtaatcgcatcatcatc
gccggccgcgacagcgcgcaggacagcatcaatcaggtcggccaggagatgacccggcgc
aacatgaacatccagccgacgctgactgaacggcccggcctgccggtgcggatcatcgtc
aaccgcgacttggtgttgcggccgtaccagccgatgttcttccagcggggagcgatgcaa
tga

DBGET integrated database retrieval system