KEGG   Acidovorax sp. JS42: Ajs_2905
Entry
Ajs_2905          CDS       T00455                                 
Name
(GenBank) TrbL/VirB6 plasmid conjugal transfer protein
  KO
K07344  type IV secretion system protein TrbL
Organism
ajs  Acidovorax sp. JS42
Pathway
ajs02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:ajs00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Ajs_2905
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ajs02044]
    Ajs_2905
Secretion system [BR:ajs02044]
 Type IV secretion system
  Trb secretion system protein
   Ajs_2905
SSDB
Motif
Pfam: TrbL SseC
Other DBs
NCBI-ProteinID: ABM43046
UniProt: A0A9J9FW90
Position
complement(3079554..3080888)
AA seq 444 aa
MNDISIIDHFLDVFSRYIDSGFGLLHGEVAFLTATLIVIDMTLAGLFWAMSHASGQGEDV
IAKLIRKVLYVGAFAYIIGNFNTLASIVFRSFAGLGLTASGSTLSMGNFLQPGRLAKVGI
DAGAPILEQIKEMAGFPEVFIHIMPIVVLFFAWMVVIVSFFVLAVQLFVTLIEFKLTTLA
GFVLVPFALWNKTAFLAEKVLGNVVSSGIKVLVLAVIVGIGSGLFSEFNIPAGSEPSIDR
ALVIMLASLAMLALGIFGPGIATGLVSGGPQLGAGAMAGAAIGAAGTAVAVGAAATGVGS
AVAAGARMAPAVARSMASTASSARSAYQAGSASAGGGLKGAAAGVGNVAKTGAQAAGQKV
ADGARSMKERMAAAFRPDDTPASGAAPAGPDAAGSSPSAEQPAWAERLHRKQQLTHAATT
AAHTLRGGDGGSSSQGPSLRDSDS
NT seq 1335 nt   +upstreamnt  +downstreamnt
atgaatgacatttcgatcattgaccattttctcgatgtcttctcgcgctacatcgactcg
ggcttcgggctgctgcacggcgaggtggcatttctcacggccacgctgatcgtcatcgac
atgacgctcgccgggctgttctgggccatgagtcatgccagcggccagggcgaggacgtg
atcgccaagctgatccgcaaggtgctttatgtcggtgccttcgcctacatcatcggcaac
ttcaacaccttggcgagcatcgtgttccgctcgttcgccgggctgggcctgacggccagc
ggctcgaccctgagcatgggtaacttcttgcagccgggacggctcgccaaagtgggcatc
gacgccggggcgcccattcttgagcagatcaaggagatggcgggcttccccgaggtgttc
attcacatcatgcccatcgtcgtgctgttcttcgcatggatggtggtcatcgtcagcttc
ttcgtgctggcggtgcagctcttcgtgacgctgatcgagttcaagctgaccacgctggcg
ggcttcgtgctggtgccgttcgccctctggaacaagacggcgttcctggccgagaaggtg
ttgggcaacgtggtgtcctcgggcatcaaggttctggtgctggccgtcatcgttggcatc
ggctcggggctgttctccgagttcaacataccggccggttcggagccttcgatcgaccgg
gcgttggtcatcatgctggcctcgctcgccatgctggccctgggcatcttcgggccgggc
attgcgactgggctggtgtccggtggcccgcagctcggcgcgggcgcgatggctggtgct
gctatcggcgcagccggaaccgccgtggcagtcggtgccgcggctacgggcgtcggcagt
gctgtggcggctggggcacgcatggcacccgccgtcgcccgctcgatggcatcgacggcc
agcagcgccaggtcggcgtaccaggcgggctccgcctcggccggtggtggcctcaagggc
gccgccgctggtgtgggcaatgtggccaagaccggcgcgcaggcggccgggcagaaggtg
gccgacggggcgcgctcgatgaaagagcgcatggcggcggcttttcggcctgacgacacg
ccggcatccggcgccgcacccgccgggcctgacgctgccggctcatctccgtccgccgag
caacccgcctgggccgagcgcctgcatcgcaagcagcagcttacccatgccgcaaccacc
gccgcccacacgctgcgcggcggcgatggtggcagctccagccaggggccgagcctgcgc
gattccgattcctga

DBGET integrated database retrieval system