KEGG   Acidovorax sp. JS42: Ajs_2908Help
Entry
Ajs_2908          CDS       T00455                                 

Definition
(GenBank) AAA ATPase
  KO
K20530  type IV secretion system protein TrbE [EC:7.4.2.8]
Organism
ajs  Acidovorax sp. JS42
Pathway
ajs02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:ajs00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Ajs_2908
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ajs02044]
    Ajs_2908
Enzymes [BR:ajs01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     Ajs_2908
Secretion system [BR:ajs02044]
 Type IV secretion system
  Trb secretion system protein
   Ajs_2908
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CagE_TrbE_VirB DUF853 AAA_10 AAA_22 TraG-D_C CbiA TrwB_AAD_bind AAA_16 DUF87 FtsK_SpoIIIE NACHT T2SSE RsgA_GTPase AAA_29 ABC_tran
Motif
Other DBs
NCBI-ProteinID: ABM43049
UniProt: A1W9X4
Position
complement(3081945..3084380)
Genome map
AA seq 811 aa AA seqDB search
MLNLAEYRQRPALLADWLPWAGLIAPGVVLNKDGSFQRTARFRGPDLDSATQGELIATSA
RLNNALRRMGSGWALFIEAERRPAADYPHSEFPEPLSWLVDEERRATFEDSGNHFESGYH
LTLVYLPPEESRARAAGMLYENRPTEGVDWRERLTAFVAETDRIFDLLDGVMPEIAWLDD
SQTLTFLHATISTRRCRVGVPEVPFHIDALLTDSALVGGLAPMLGGQHLRVVSVRGFPTS
TWPGILDDLNRLGFGYRWSTRFLCMDKADAEKELFRLRRQWFAKRKNVIALLRETIFQQE
TPLVDTDASNKSADADAALQELGSDQVAFGYVTTTVTVLDAEPAKADEKLRMVERVIQGR
GFVTMPEALNAVDAWLSSIPGHAYANVRQPIVSTLNLAHLMPVSAVWAGPERNNHLNGPP
LIVTRTDGATPFRLVTHIGDVGHTLVAGPTGMGKSVLLATLAMQFRRYRGSRILAFDMGR
SIRATVLGLGGEHYDLGMDGEIAFQPLARIDHEGYRTWAAEWVEGRLVHEGVTVGPEEKA
AIWSALGSLAGAPLEQRTMTGLSVLLQSNALRQALAPYVLGGAHGKLLDADSDRLGSGAV
QCFEMEELMHSKAAVMAVLHYLFARFDERFDGAPTLLILDEAWLFLDDPVFAARIRQWLK
TLRKKNVSVIFATQSLADIKDSSIAPAIIESCASRIFLPNPQATEPQIRAIYEGFGLNSR
QIEIVATAQPKRDYYYQSRLGNRLFDLDLGAATLAFAGASTPQDQRDIDAVLAATSASTP
FAAAWLRHRGLHWAAELLSSFPSTHPKENPS
NT seq 2436 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaccttgccgaatatcgccagcgcccggccttgctcgccgactggttgccctgg
gccgggctgatcgcaccgggcgtcgtcttgaacaaggacggcagtttccagcgcacggcc
cggtttcgcgggcctgacctcgatagcgcaacgcaaggcgaactgattgccacgtcggcg
cgcttgaacaacgcgctgcgtcgtatgggttcgggctgggcgctgttcatcgaagccgag
cgccggcccgcagccgactatccgcactcggagtttcccgagccgttgtcgtggctggtg
gacgaggaacgccgcgctacgttcgaggactcgggcaaccacttcgagagcggctaccac
ctgacgctggtgtacctgccgcccgaggaatcacgcgcccgcgcggccgggatgctgtac
gagaaccggcccaccgaaggcgtggactggcgcgagcgcctgacggccttcgtcgcggaa
accgatcgcatcttcgacctgctcgatggcgtgatgccggaaatcgcgtggctggacgac
agccagacgctgaccttcctgcacgccaccatctcgacgcggcgctgtcgcgtcggcgtg
cctgaagtgcctttccacatcgatgcgctgctgaccgactccgcgctggtcggtggcctg
gcgcccatgctgggcggccagcacctgcgcgtggtgtcggtgcgtggcttcccgacctcg
acttggccggggattctggatgacctcaaccgcctcggctttggctatcgctggtccacc
cggttcctctgcatggacaaagccgatgcggaaaaggagctgttccgcctgcgccgccag
tggttcgccaagcgcaagaacgtgatcgcgctgctgcgcgaaaccatcttccagcaggaa
accccgctggtcgataccgacgccagcaacaaatcggccgatgcggacgcggccttgcag
gaactgggcagcgatcaggtggccttcgggtatgtcaccaccacggtgacggtgctcgat
gccgaaccggcgaaggccgacgagaagctgcgcatggtggagcgggtcatccagggccgg
ggcttcgtgacgatgcccgaggccttgaacgcggtggatgcctggctgtcgtccattccc
ggccatgcctacgccaacgtgcgccagcccatcgtctcgacgctgaacttggcgcacctg
atgccggtgtcggcggtatgggccggccccgagcgcaataaccatctcaacggcccgccg
ctgatcgtgacgcgcaccgacggcgcgacaccgttccggctggtgacgcacatcggcgac
gtgggccacacgctggtcgcggggccgaccggcatgggcaagtcggtgctgctcgccacc
ttggcgatgcagttccggcgctatcgcggatcgcgcatcctcgcgttcgacatgggccgc
tccatccgggcaacggtgctgggcctgggcggcgagcactacgacctcggtatggatggc
gagatcgccttccagcccctggcccgcatcgaccatgagggctatcggacgtgggccgcc
gagtgggtcgaaggccggctggtgcatgaaggcgtgaccgtcggcccggaggagaaggct
gccatctggtcggcgctcggcagcctcgccggtgctccgctggagcagcgcacgatgacc
ggcctgtcggtgctgctgcaatcgaacgcgctgcgccaggcgctcgcgccctacgtgctc
ggcggcgcccacggcaagctgctggatgcggattcggatcgcctgggttccggcgccgtg
cagtgcttcgagatggaagagctgatgcacagcaaggccgccgtcatggccgtgctgcac
tacctctttgcccggttcgatgaacgctttgacggtgcgcccacgctgctgatcctcgat
gaggcgtggctgtttctcgatgacccggtgttcgcggcccgcatccgccagtggctcaag
acgctgcgcaagaagaacgtcagcgtcatcttcgccacgcagagcctggccgacatcaag
gattcgagcatcgcgccggccatcatcgagagctgcgccagccgcatcttcctgcccaac
ccgcaggcgaccgagccgcagatcagggctatctacgaaggcttcgggctgaactcgcgc
cagatcgaaatcgtcgccaccgcgcagcccaagcgcgactactactaccaatcccgtctc
ggcaaccgcctgttcgacctcgacctgggcgccgcgaccttggccttcgcgggtgcttcc
acgccgcaagaccagcgcgacatcgacgcggtgctcgccgctacatctgcatccaccccg
ttcgcagccgcctggctgcgccaccgcggcctgcattgggcggccgaactgctgtcctcg
ttcccgtccacccaccccaaggagaacccatcatga

DBGET integrated database retrieval system