KEGG   Acidovorax sp. JS42: Ajs_3092
Entry
Ajs_3092          CDS       T00455                                 

Definition
(GenBank) phenylpropionate dioxygenase alpha subunit
  KO
K14579  naphthalene 1,2-dioxygenase subunit alpha [EC:1.14.12.12 1.14.12.23 1.14.12.24]
Organism
ajs  Acidovorax sp. JS42
Pathway
ajs00624  Polycyclic aromatic hydrocarbon degradation
ajs00626  Naphthalene degradation
ajs00627  Aminobenzoate degradation
ajs00633  Nitrotoluene degradation
ajs00642  Ethylbenzene degradation
ajs01100  Metabolic pathways
ajs01120  Microbial metabolism in diverse environments
ajs01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ajs00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Ajs_3092
   00633 Nitrotoluene degradation
    Ajs_3092
   00642 Ethylbenzene degradation
    Ajs_3092
   00626 Naphthalene degradation
    Ajs_3092
   00624 Polycyclic aromatic hydrocarbon degradation
    Ajs_3092
Enzymes [BR:ajs01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.12  naphthalene 1,2-dioxygenase
     Ajs_3092
    1.14.12.23  nitroarene dioxygenase
     Ajs_3092
    1.14.12.24  2,4-dinitrotoluene dioxygenase
     Ajs_3092
SSDB
Motif
Pfam: Ring_hydroxyl_A Rieske
Other DBs
NCBI-ProteinID: ABM43221
UniProt: A1WAE6
Position
3262073..3263416
AA seq 447 aa
MSYQNLVSEAGLTQKLLIHGDKELFQHELKTIFARNWLFLTHDSLIPSPGDYVTAKMGVD
EVIVSRQNDGSVRAFLNVCRHRGKTLVHTEAGNAKGFVCGYHGWGYGSNGELQSVPFEKE
LYGDAIKKKCLGLKEVPRIESFHGFIYGCFDAEAPPLIDYLGDAAWYLEPTFKHSGGLEL
VGPPGKVVVKANWKPFAENFVGDIYHVGWTHAAALRAGQSVFSSLAGNAKLPPEGAGLQM
TSKYGSGMGLTWDYYSGNFSADMVPDLMAFGAAKQEKLAKEIGDVRARIYRSILNGTVFP
NNSFLTGSATFKVWNPIDENTTEVWTYAFVEKDMPEDLKRRLADAAQRSIGPAGFWESDD
NENMETLSQNAKKYQSSNSDQIASLGFGKDVYGDECYPGVVGKSAIGETSYRGFYRAYQA
HISSSNWAEFENASRNWHTELTKTTDR
NT seq 1344 nt   +upstreamnt  +downstreamnt
atgagttaccaaaacttagtgagtgaagcagggctgacgcaaaagctcctgattcatggc
gacaaagaacttttccagcacgaattgaagaccatcttcgcgcggaactggctttttctg
acccatgacagtctgattccctcccccggcgactatgtcacagccaaaatgggcgtcgat
gaagtcatcgtctcccgccagaacgatggctcggtgcgagcctttttgaatgtttgccgt
caccggggcaagacactagttcacactgaagccggaaatgcgaaaggctttgtgtgcggc
taccacggctggggctacggttccaacggcgaactgcaaagcgttccctttgaaaaagag
ttgtacggagatgcgatcaaaaagaaatgcctgggcttgaaagaagtcccccgcatcgaa
agctttcatggctttatctatggctgttttgatgcagaagctcccccgctcatcgattat
ctgggtgatgcagcctggtacctggaacccaccttcaagcactctggtggcctggaactt
gtaggcccccccggcaaagtggtggttaaggccaactggaagccttttgcggaaaacttt
gtaggtgacatctaccacgttggttggacgcacgcagcggctttgcgcgcagggcagtcg
gtatttagttctcttgcgggcaacgctaagcttccacccgaaggcgcgggcttgcaaatg
accagcaagtatggcagtggaatgggcttaacgtgggactactactccggtaacttcagc
gctgatatggttcccgatctgatggcattcggcgccgcaaaacaggaaaaactcgccaag
gaaatcggcgatgtccgggcacggatttaccgcagcattctgaacggcacggttttcccg
aacaacagctttttgaccggctccgctaccttcaaggtctggaacccgatcgatgaaaac
acgaccgaggtttggacgtatgccttcgtagaaaaagacatgcctgaggacttaaagcgt
cgcttggctgacgcggctcagcgcagtatcggaccagcaggattctgggaaagcgacgac
aacgaaaacatggagacgttgtcgcaaaatgccaagaaataccaatccagcaacagtgat
cagattgccagtttgggtttcggcaaggacgtctacggcgacgaatgctatccgggcgtc
gttggcaaatcggcaatcggcgaaaccagctatcgcggattctaccgtgcctaccaggct
cacatcagcagctccaattgggccgagttcgaaaatgcctcccgaaattggcacaccgaa
ctcaccaagacaactgatcgctaa

DBGET integrated database retrieval system