KEGG   Acidovorax sp. JS42: Ajs_3093
Entry
Ajs_3093          CDS       T00455                                 

Definition
(GenBank) aromatic-ring-hydroxylating dioxygenase, beta subunit
  KO
K14580  naphthalene 1,2-dioxygenase subunit beta [EC:1.14.12.12 1.14.12.23 1.14.12.24]
Organism
ajs  Acidovorax sp. JS42
Pathway
ajs00624  Polycyclic aromatic hydrocarbon degradation
ajs00626  Naphthalene degradation
ajs00627  Aminobenzoate degradation
ajs00633  Nitrotoluene degradation
ajs00642  Ethylbenzene degradation
ajs01100  Metabolic pathways
ajs01120  Microbial metabolism in diverse environments
ajs01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ajs00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Ajs_3093
   00633 Nitrotoluene degradation
    Ajs_3093
   00642 Ethylbenzene degradation
    Ajs_3093
   00626 Naphthalene degradation
    Ajs_3093
   00624 Polycyclic aromatic hydrocarbon degradation
    Ajs_3093
Enzymes [BR:ajs01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.12  naphthalene 1,2-dioxygenase
     Ajs_3093
    1.14.12.23  nitroarene dioxygenase
     Ajs_3093
    1.14.12.24  2,4-dinitrotoluene dioxygenase
     Ajs_3093
SSDB
Motif
Pfam: Ring_hydroxyl_B PTS_2-RNA
Other DBs
NCBI-ProteinID: ABM43222
UniProt: A1WAE7
Position
3263431..3264015
AA seq 194 aa
MMINTQEDKLVSAHDAEEFHRFFIVQDDALLQEVNTLLTREAHLLDIQAYKAWLEHCVAP
EIKYQVISRELRSTSERRYQLNDAVNLYNENYQQLKVRVEHQMDPQNWANNPKIRFTRFV
TNVTAAKDKSAPEMLHVRSNLILHRARRENQVDVFYATREDKWKRIEGGGIKLVERFVDY
PERIPQTHNLLVFL
NT seq 585 nt   +upstreamnt  +downstreamnt
atgatgatcaatacccaggaagacaagctggtctccgcgcacgacgccgaagaatttcac
cgtttcttcatcgtacaagatgatgcactactgcaagaagtcaacacgctcctgacccgc
gaagcgcacctgctggacattcaggcctacaaagcctggcttgaacactgcgttgccccc
gagatcaaataccaagtgatctcgcgagaacttcgctccacttccgagcgtcgataccaa
ctgaatgatgcggtgaatctctacaacgagaactatcaacagctgaaagttcgagttgaa
caccagatggatcctcagaactgggccaacaacccgaagatccgcttcacccgcttcgtc
accaatgtcacggcggccaaggacaagagcgcaccggaaatgctgcatgtgcggtccaac
ctcattctccatcgcgccagacgagaaaaccaagttgacgtcttctatgcaacgcgtgaa
gacaaatggaaacgcatcgaaggtggtggtatcaaattggtcgaacgctttgtggactac
ccggagcgcattccccagacccacaacctgttggtcttcctgtga

DBGET integrated database retrieval system