KEGG   Acidovorax sp. JS42: Ajs_3153Help
Entry
Ajs_3153          CDS       T00455                                 

Definition
(GenBank) two component transcriptional regulator, winged helix family
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
ajs  Acidovorax sp. JS42
Pathway
ajs02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ajs00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ajs_3153
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:ajs02022]
    Ajs_3153
Two-component system [BR:ajs02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   Ajs_3153
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C FleQ DUF43
Motif
Other DBs
NCBI-ProteinID: ABM43278
UniProt: A1WAK3
Position
3333427..3334158
Genome map
AA seq 243 aa AA seqDB search
MASTTNRTDKVLVVDDDARIRDLLRRYLTQEGFEVMVAEDGKALNRILLRETVDLIVLDL
MMPGEDGLSICRRLRAANDRTPIIMLTAKGEDVDRIVGLEVGADDYLGKPFNPRELLARI
HAVLRRRPPQEAPGAPSGDNEVVTFGPFTFDLGTRALQKNGEELPLTTGEFAMLKALVRH
PRQPLSREKLALLARGREFEPFDRSLDVQISRLRKLVEVDAAAPRYIQTVWGVGYVFVPD
GTN
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaacaaccaaccgtaccgacaaagttctcgtggtggatgacgatgcgcgcatc
cgcgacctgctgcgccgctacctcacccaggaaggctttgaagttatggtcgcggaagac
ggcaaggccctcaaccgcatcctgctgcgcgagaccgtggacctgatcgtgctggacctg
atgatgccgggggaagacggcctgtcgatctgccggcgcctgcgcgcggccaatgaccgc
acgcccatcatcatgctgaccgccaagggcgaggacgtggaccgcatcgtgggcctggaa
gtgggcgccgacgactacctgggcaagcccttcaacccgcgcgaactgctggcccgcatc
cacgccgtgctgcgccgccgcccgccgcaggaggccccgggcgcaccgtcgggcgacaac
gaagtggtgaccttcggccccttcaccttcgacctgggcacgcgcgcgctgcaaaagaac
ggcgaggaactgccgctgaccacgggcgaattcgccatgctgaaagccctggtgcgccac
ccgcgccagccgctgtcgcgcgaaaagctcgcgctgctggcgcgcgggcgcgagttcgag
ccgttcgaccgcagcctggacgtgcagatctcgcgcctgcgcaagctggtcgaggtggac
gccgccgcgccgcgctacatccagaccgtttggggtgtgggctacgtgttcgtgccggac
ggcacgaactga

DBGET integrated database retrieval system