KEGG   Acidovorax sp. JS42: Ajs_3358Help
Entry
Ajs_3358          CDS       T00455                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
ajs  Acidovorax sp. JS42
Brite
KEGG Orthology (KO) [BR:ajs00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Ajs_3358
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Myc_target_1 FeoB_C
Motif
Other DBs
NCBI-ProteinID: ABM43480
UniProt: A1WB55
Position
complement(3548192..3549202)
Genome map
AA seq 336 aa AA seqDB search
METVQTALWIVVVLVALAIVFDFMNGFHDAANSIATVVSTGVLKPTQAVVFAAFFNFVAI
FVFHLSVAATIGKGIVDPSVVDTHVIFGALVGAITWNVITWYYGIPSSSSHALIGGIVGA
VIAKTGAGALVASGIFKTVAFIFVSPMLGFLLGSLMMLIVAWVFRRTSPNRVDKWFRRLQ
LVSAGAYSLGHGGNDAQKTIGIIWLLLIATGYASAGDASPPMWVIISCYAAIGMGTMFGG
WRIVKTMGQKITKLKPVGGFCAETGGAMTLFIATALGIPVSTTHTITGAIVGVGSTQRAS
AVRWGVAGNIVWAWILTIPASAFVAAIAYWVSLQLY
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggaaacagtacaaaccgccctgtggatcgtggtcgtgctcgtggcgctcgccatcgtg
ttcgacttcatgaacgggttccacgacgccgccaactccatcgccaccgtggtctccacg
ggcgtgctcaagcccacgcaggccgtggtcttcgcggccttcttcaacttcgtcgccatc
ttcgtgttccacctgagcgtggcggccaccatcggcaagggcatcgtggacccgagcgtg
gtggacacccacgtgatcttcggcgcgctggtgggggccatcacctggaacgtcatcacc
tggtactacggcatccccagcagctcatcgcatgcactgatcggcggcatcgtgggcgcg
gtgatcgccaagaccggcgcgggcgcactggtggccagcggcatcttcaagaccgtggcc
tttatcttcgtgtcgcccatgctgggtttcctgctgggctctttgatgatgctgatcgtg
gcctgggtcttccgtcgcaccagtccgaaccgcgtggacaagtggttccgccggctgcag
ctcgtctccgccggggcctacagcctgggccacggcggcaacgacgcgcaaaagaccatc
ggcatcatctggctgctgctgatcgccacgggctacgcctcggcgggcgatgcctcgccc
cccatgtgggtcatcatctcgtgctacgcggccatcggcatgggcaccatgttcggcggc
tggcgcatcgtgaagaccatgggccagaaaatcaccaagctcaagcccgtgggaggcttc
tgcgccgagaccggcggcgcgatgacgctgttcatcgccactgcgctgggcatccccgtg
tccaccacccacaccatcacgggcgcgatcgtgggcgtgggctccacccagcgcgccagc
gccgtgcgctggggcgtggccggcaacatcgtctgggcgtggatcctgaccatccccgcc
agcgccttcgtggcggcgatcgcctattgggtgagcctgcagctctattga

DBGET integrated database retrieval system