KEGG   Acidovorax sp. JS42: Ajs_3398Help
Entry
Ajs_3398          CDS       T00455                                 

Definition
(GenBank) FMN adenylyltransferase
  KO
K11753  riboflavin kinase / FMN adenylyltransferase [EC:2.7.1.26 2.7.7.2]
Organism
ajs  Acidovorax sp. JS42
Pathway
ajs00740  Riboflavin metabolism
ajs01100  Metabolic pathways
ajs01110  Biosynthesis of secondary metabolites
Module
ajs_M00125  Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:ajs00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    Ajs_3398
Enzymes [BR:ajs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.26  riboflavin kinase
     Ajs_3398
   2.7.7  Nucleotidyltransferases
    2.7.7.2  FAD synthetase
     Ajs_3398
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_syn Flavokinase
Motif
Other DBs
NCBI-ProteinID: ABM43518
UniProt: A1WB93
Position
3586366..3587409
Genome map
AA seq 347 aa AA seqDB search
MKIFRGFHHPEVAPACALTIGNFDGVHRGHQAMLALLNSEAQHRGVQSCVLTFEPHPRDY
FAGVHKRPDLAPARIGTLRDKLSELARCGVQQTIVLPFNEKLARQAPQAFIDDVVVGGLG
ARYLLVGDDFRFGAQRAGDYAMLDTAGRERGFEVARMNSYEVHGLRVSSSAVRDALGAGD
MEEATRLLGRPYAISGHVVHGRKLGRSLGRSAASGPHQDGFRTLNLRFAHWKPAASGIFA
VLVHGLDAEPLPGVANLGVRPSLDPSDVNGGRVLLETHCLQWPAHLGAEGAYGKIVRVEL
LHKLHDELKYDSLGALTTGIAKDCDDARAYFASSHAETRRQTTRDRI
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcttccgcggcttccatcacccggaggtggcaccggcctgcgccctcaccatc
ggcaatttcgacggcgtgcaccgcggccaccaggccatgctggccctgctgaacagcgag
gcgcagcaccgcggcgtgcaaagctgcgtgctgaccttcgagccgcatccgcgcgactac
ttcgccggggtgcacaagcgcccggatctcgcgcccgcgcgcatcggcacgctgcgcgac
aagctgtccgagctggcgcgctgcggcgtgcagcagaccatcgtgctgccgttcaacgaa
aagctggcacgccaggcaccccaggccttcatcgacgatgtggtggtgggcggcctgggt
gcgcgctacctgctggtgggcgacgatttccgcttcggcgcccagcgcgcgggggactac
gccatgctggacaccgccggccgcgagcgcggcttcgaggtggcgcgcatgaacagctac
gaggtgcacgggctgcgtgtttccagctccgccgtgcgcgacgccctgggcgccggcgac
atggaggaagccactcgcctgctggggcgcccgtacgcgatctctggccacgtggtgcat
ggacgcaagctgggccggtcgctgggccgctcagccgccagcgggccccaccaggacggc
tttcgcacgctgaacctgcgcttcgcgcactggaaacccgccgccagcggcatcttcgcg
gtactggtgcacgggctggacgccgagcccctgcccggtgtggccaacctgggcgtgcgc
ccgtcgctggacccgagcgacgtgaacggcgggcgcgtgctgctggagacgcattgcctg
cagtggcccgctcacctgggggccgagggggcctacggtaaaatcgtgcgcgtggaactc
ctgcacaaactgcacgacgagctgaagtacgacagcctgggcgccctcacaaccggcatc
gccaaggactgcgatgacgcccgcgcgtacttcgcatcctcccacgcagagacccgtcgc
cagaccacccgcgaccgaatttga

DBGET integrated database retrieval system