KEGG   Acidovorax sp. JS42: Ajs_3483Help
Entry
Ajs_3483          CDS       T00455                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
ajs  Acidovorax sp. JS42
Pathway
ajs00450  Selenocompound metabolism
ajs00970  Aminoacyl-tRNA biosynthesis
ajs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ajs00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Ajs_3483
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Ajs_3483
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ajs01007]
    Ajs_3483
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ajs03016]
    Ajs_3483
Enzymes [BR:ajs01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Ajs_3483
Amino acid related enzymes [BR:ajs01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Ajs_3483
Transfer RNA biogenesis [BR:ajs03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Ajs_3483
 Prokaryotic type
   Other AARSs
    Ajs_3483
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: ABM43596
UniProt: A1WBH1
Position
3678478..3680544
Genome map
AA seq 688 aa AA seqDB search
MTARKIFVTTALPYANGNFHIGHIMEYIQADTWVRAQRMQGNAVNFVGADDAHGAPIMIA
AEKAGKTPQQFVADIAAGRKQYLDGFHIAFDNWSNTDSPENHELSQQIYLDLKAAGFIET
RTIEQFFDPEKNMFLPDRFIKGECPRCHAKDQYGDNCEVCSSVYAPTDLINPYSALSGAK
PVLKTSEHFFFKLSDPRAVEFLTEWTQNGQHVQPEVAAKIKEWFGTRTNPDGTTSEGLDD
WDISRDAPYFGIEIPDAPGKYFYVWLDAPVGYLASLKNLLNKRGEDYDAYMADPQLEQYH
FIGKDIITFHTLFWPAMLKFSGRKTPTKICVHGFMTVNNGEKMSKSRGTGLDPLKYLALG
MNPEWLRYYLGAKLNGKNEDIDFNPEDFMARVNSDLIGKYVNIASRAAGFIFKRFGGKLG
EVSADGQALLAQLREQAGPIVAAYEARDTARAVRETMLLCDRVNSYVDANKPWELAKQEG
MEARLQDVCTTCIEAFRILTIYLKPILPQVAAEVARFLIVPPEQFAEVAQPLGAGHQIGQ
YQHLMQRVTQEQLDALFEPPAPAVEKVIPGGEEIAPTITIDDFAKVDLRIAKIVKCEAVE
GSTKLLRLTLDVGEGQTRNVFSGIASMYKPKDLQGKLTVMVANLAPRKMKFGLSEGMVLA
ASHADEKAHPGIFVLEPFPGAQPGMRIH
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcacgcaagatcttcgtcaccaccgccctgccgtatgccaacggcaatttccac
atcggccacatcatggagtacatccaggccgacacctgggtgcgcgcgcagcgcatgcag
ggcaacgcggtcaatttcgtcggcgcggacgacgcccatggcgcgcccatcatgattgcc
gccgagaaggcgggtaagacgccccagcagtttgtggccgacatcgccgccgggcgcaag
caatacctggatggctttcacatcgccttcgacaactggagcaacaccgacagcccggag
aaccacgagctgtcccagcagatctacctggacctgaaggccgccggtttcatcgagacg
cgcaccatcgagcagttcttcgacccggagaagaacatgttcctgcccgaccgcttcatc
aagggcgagtgcccgcgctgccatgccaaggaccagtacggcgacaactgcgaggtctgc
agctcggtctacgcgcccaccgacctcatcaacccgtactcggcgctgtcgggcgccaag
ccggtgctcaagacctccgagcacttcttcttcaagctctccgacccgcgcgcggtggag
tttctgaccgagtggacgcagaacggccagcatgtgcagcccgaggtggccgccaagatc
aaggaatggttcggcacgcgcaccaatcccgacggcacgaccagcgaaggtctggacgac
tgggacatctcccgcgacgccccctatttcggcatcgagatccccgacgcgccgggcaag
tacttctacgtgtggctggacgcccccgtgggctacctggcctcgctcaagaacctcttg
aacaagcgcggcgaggactacgacgcctacatggccgacccgcagctggagcagtaccac
ttcatcggcaaggacatcatcaccttccacacgctgttctggcccgccatgctgaagttc
agcggccgcaagacgcccacgaagatctgcgtgcacggcttcatgaccgtgaacaacggc
gagaagatgagcaagagccgcggcacggggctggacccgctcaaatacctggccctgggc
atgaaccccgagtggctgcgctactacctgggcgccaagctcaacggcaagaacgaagac
atcgacttcaaccccgaagacttcatggcccgcgtgaattccgacctgatcggcaagtac
gtgaacatcgccagccgtgccgcgggcttcatcttcaagcgcttcggcggcaagctgggc
gaagtcagcgccgatggccaggcgctgctggcgcagctgcgcgaacaggccggtcccatc
gttgcggcctacgaggcgcgcgacacggcccgcgccgtgcgcgagaccatgctgctgtgc
gaccgcgtgaacagctacgtggacgccaataagccctgggagctggccaagcaggagggc
atggaggcgcgcctgcaggacgtctgcaccacctgcatcgaggccttccgcatcctgacg
atctacctcaagcccatcctgccgcaggtggctgccgaggtggcccgctttctcatcgtg
ccgcccgagcagtttgccgaagtggcccagcccctgggcgccggccaccagatcggccag
taccagcacctgatgcagcgcgtgacgcaggagcagttggacgcgctgttcgagcccccg
gctcccgcagtcgaaaaggtcatccctggcggagaggaaatcgccccgacgatcaccatc
gacgactttgccaaggtggatctgcgcatcgcgaagatcgtgaaatgcgaggccgtggaa
ggctccaccaagctgctgcgcctgacactggacgtgggcgaagggcagacacgcaacgtc
ttcagcggcatcgccagcatgtacaagcccaaggacctgcagggcaagctcacggtgatg
gtggccaatctggcgccgcgcaagatgaagttcggcctgagcgagggcatggtgctggcc
gccagccacgccgatgagaaggcgcaccccggcatcttcgtactggagcctttccccggc
gcgcagccgggcatgcgcatccactga

DBGET integrated database retrieval system