KEGG   Acidovorax sp. JS42: Ajs_3505Help
Entry
Ajs_3505          CDS       T00455                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ajs  Acidovorax sp. JS42
Pathway
ajs00010  Glycolysis / Gluconeogenesis
ajs00260  Glycine, serine and threonine metabolism
ajs00680  Methane metabolism
ajs01100  Metabolic pathways
ajs01110  Biosynthesis of secondary metabolites
ajs01120  Microbial metabolism in diverse environments
ajs01130  Biosynthesis of antibiotics
ajs01200  Carbon metabolism
ajs01230  Biosynthesis of amino acids
Module
ajs_M00002  Glycolysis, core module involving three-carbon compounds
ajs_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ajs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ajs_3505
  Energy metabolism
   00680 Methane metabolism
    Ajs_3505
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ajs_3505
Enzymes [BR:ajs01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Ajs_3505
Membrane trafficking [BR:ajs04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Ajs_3505
Exosome [BR:ajs04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Ajs_3505
  Exosomal proteins of melanoma cells
   Ajs_3505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ABM43618
UniProt: A1WBJ3
Position
3700569..3701312
Genome map
AA seq 247 aa AA seqDB search
MHKLVLIRHGESTWNLENRFTGWTDVDLTPTGIEQAKNAGRLLKAEGYDFDLAYTSVLKR
ATRTLWHCLDEMDRTWLPVEHSWRLNERHYGALQGLNKADMAKQYGDAQVLVWRRSYDTP
PPALEPTDPRCERGDIRYAGLAPEQVPLTECLKDTVARVLPYWNEAIAPTIRSGKRVLIA
AHGNSIRALVKYLDGISDQDIVGLNIPNGIPLVYELDAELKPLRSYYLGDAEATAKAAAA
VAAQGKA
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgcacaaactcgttctgatccgccacggcgaatccacgtggaatctggaaaaccgcttc
accggctggaccgatgtggatctgacccccacgggcatcgagcaggccaagaatgccggc
cgcctgctcaaggccgagggctacgattttgacctggcctacaccagtgtgctcaagcgc
gccacgcgcacgctgtggcactgcctggacgagatggaccgcacctggctgcccgtggag
cacagctggcgcctgaacgagcgccactacggcgctctgcagggcctgaacaaggccgac
atggccaagcagtatggcgacgcgcaagtgctggtctggcgccgcagctacgacacgccg
ccgccggccctggagcccaccgacccgcgctgcgagcgcggcgacatccgctacgcgggc
ctggcgcccgagcaggtgccgctgaccgagtgcctcaaggacacggtggcgcgcgtgctg
ccctactggaacgaagccatcgcgccaacgatccgctcgggcaagcgtgtgctgatcgca
gcgcacggcaactccatccgcgcgctggtcaagtacctggacggcatctccgaccaagac
atcgtgggcctgaacattcccaacggcattccgctggtgtacgagctggacgcggaactc
aagcccctgcgcagctactacctgggcgacgccgaggccaccgccaaggccgccgccgcc
gtggccgcgcagggcaaggcctga

DBGET integrated database retrieval system