KEGG   Acidovorax sp. JS42: Ajs_3623Help
Entry
Ajs_3623          CDS       T00455                                 

Definition
(GenBank) short chain enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ajs  Acidovorax sp. JS42
Pathway
ajs00071  Fatty acid degradation
ajs00280  Valine, leucine and isoleucine degradation
ajs00281  Geraniol degradation
ajs00310  Lysine degradation
ajs00360  Phenylalanine metabolism
ajs00362  Benzoate degradation
ajs00380  Tryptophan metabolism
ajs00410  beta-Alanine metabolism
ajs00627  Aminobenzoate degradation
ajs00640  Propanoate metabolism
ajs00650  Butanoate metabolism
ajs00903  Limonene and pinene degradation
ajs00930  Caprolactam degradation
ajs01100  Metabolic pathways
ajs01110  Biosynthesis of secondary metabolites
ajs01120  Microbial metabolism in diverse environments
ajs01130  Biosynthesis of antibiotics
ajs01212  Fatty acid metabolism
Module
ajs_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ajs00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Ajs_3623
   00650 Butanoate metabolism
    Ajs_3623
  Lipid metabolism
   00071 Fatty acid degradation
    Ajs_3623
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Ajs_3623
   00310 Lysine degradation
    Ajs_3623
   00360 Phenylalanine metabolism
    Ajs_3623
   00380 Tryptophan metabolism
    Ajs_3623
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Ajs_3623
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Ajs_3623
   00281 Geraniol degradation
    Ajs_3623
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Ajs_3623
   00627 Aminobenzoate degradation
    Ajs_3623
   00930 Caprolactam degradation
    Ajs_3623
Enzymes [BR:ajs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Ajs_3623
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: ABM43735
UniProt: A1WBW0
Position
3827924..3828757
Genome map
AA seq 277 aa AA seqDB search
MKAWVYSRHPTHYKQEITLAYECIEVRTEADKVGIITLARPKQLNALNDQLMTELGEALK
AFDADEKIGCIILTGSEKAFAAGADIGAMAKYSFADAYKGDYITRNWEQIRSIRKPVIAA
VSGYALGGGCELAMMCDFIIAADNAKFGQPEIKLGVIPGAGGTQRLPRAVGKAKAMDMAL
TGRMMDATEAERSGLVSRVVPLDKLMEEALGAALVISGFSQIAVMAAKESVNRAFEGTLS
DGVMFERRLFHALFATQDQKEGMDAFVNKRAAVFTHQ
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcttgggtatattcccggcatcccacccactacaaacaggagatcaccttggcc
tacgaatgcatcgaagtccgcaccgaagcggacaaggtcggcatcatcacgctcgcccgt
cccaagcagctcaacgcgctcaacgaccagctcatgaccgagctgggcgaggccctcaag
gcgttcgacgccgacgagaagatcggctgcatcatcctgacgggcagcgagaaggccttc
gccgcgggcgccgacatcggcgccatggccaagtacagctttgccgatgcgtacaagggc
gactacatcacgcgcaactgggagcagatccgcagcatccgcaagcccgtcatcgcggcg
gtgagcggctacgccttgggcggcggctgcgagctggcgatgatgtgcgacttcatcatc
gcggccgacaatgccaagttcggacagcccgaaatcaagctgggcgtgatccccggcgcc
ggcggcacgcagcgcctgccgcgcgccgtgggcaaggccaaggccatggacatggccctc
accggccgcatgatggacgccacggaagccgagcgctccggcctcgtcagccgcgtggtg
ccgctggacaagctgatggaagaagccctgggcgcggccctcgtcatcagcggtttctcg
cagatcgccgtgatggccgccaaggaatcggtgaaccgcgccttcgaagggactttgagc
gatggcgtgatgttcgagcgccgcctgttccatgcgctgttcgccacccaggaccagaag
gaaggcatggacgccttcgtgaacaagcgcgcagcagtcttcacgcaccaataa

DBGET integrated database retrieval system