KEGG   Acidovorax sp. JS42: Ajs_3651Help
Entry
Ajs_3651          CDS       T00455                                 

Definition
(GenBank) cytochrome c, class I
  KO
K08738  cytochrome c
Organism
ajs  Acidovorax sp. JS42
Pathway
ajs02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ajs00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Ajs_3651
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C1
Motif
Other DBs
NCBI-ProteinID: ABM43762
UniProt: A1WBY7
Position
complement(3860734..3861210)
Genome map
AA seq 158 aa AA seqDB search
MAVAGPAPATPAPAAPQPMAPDAAQLARGQQIYARCAGCHAIEGHRTGPQHCGLFGRRSG
TAPGFDGYSPAMKASGIVWDERTLQRFLKDPPATVPGTSMGYAGVKDDGERAALIAWLRS
RLHAQVTHCSAFDSCQRLLQKRWRHFWLEVRLVPWRRL
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atggcggtcgccgggcccgctccggcaacgccagcgccggccgcgccccagcccatggcg
cctgacgcggcccagctggcgcgcggccagcagatctacgcgcgctgcgcggggtgccac
gccatcgagggccaccgcacgggaccgcagcactgcggcctgttcggccgccgctcgggc
acggcgccggggttcgacggctactccccggccatgaaggccagcggcatcgtctgggac
gagcgcacgctgcagcgcttcctgaaggacccgccagccaccgtgcccggcacgtccatg
ggctacgcaggcgtgaaggacgatggcgagcgtgcggcgctcatcgcctggctgcgcagc
cgcctgcacgcccaggtaacccattgctctgcctttgatagctgccagcgcttgctacaa
aagcgctggaggcatttttggcttgaagtgcggctggtgccatggcggcgcctatga

DBGET integrated database retrieval system