KEGG   Acidovorax sp. JS42: Ajs_4017Help
Entry
Ajs_4017          CDS       T00455                                 

Definition
(GenBank) Nitrilase/cyanide hydratase and apolipoprotein N-acyltransferase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
ajs  Acidovorax sp. JS42
Brite
KEGG Orthology (KO) [BR:ajs00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Ajs_4017
Enzymes [BR:ajs01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     Ajs_4017
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: ABM44121
UniProt: A1WCZ6
Position
complement(4278007..4278822)
Genome map
AA seq 271 aa AA seqDB search
MKVAALQMVSGVALQANLAQARHLLEQAAQAGAELAVLPEYFCAMGLADADKLALRETMG
DGVVQRFLAQAARELGLWVVGGTLPLVCDSEERVHNTTLVFSPAGDCVARYDKIHLFRFD
NGTECFDEARVIQAGRESVRFALPARDGNVWRVGLSVCYDLRFPELYRQHARAGADLLLV
PSAFTYTTGRAHWEVLLRARAVENLAYVLAPAQGGTHENGRRTWGHSMLVDPWGSVLAQQ
PEGAGVVLGTLDAAHLRQVRRQLPALEHCVL
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcgcagccttgcaaatggtctcgggcgtcgcgctgcaggccaacctggcgcag
gcgcgccatctgctggagcaggccgcgcaggcgggcgcggagctggcggtgctgcccgag
tatttctgcgccatgggcctggccgatgcggacaagctggcgctgcgcgaaaccatgggc
gacggcgtggtccagcggtttctggcgcaagcggcgcgcgagctgggcctgtgggtggtg
ggcggcacgctgccgctggtgtgcgacagcgaagagcgcgtgcacaacaccacgctggtg
ttctcgcccgcgggcgactgcgtggcgcgttacgacaagatccacctgttccgcttcgac
aacggcactgaatgcttcgatgaggcgcgcgtgatccaggccgggcgcgagagcgtgcgc
tttgccctgccggcgcgggatggcaacgtgtggcgcgtggggttgtcggtgtgctacgac
ctgcgcttccccgagctgtaccgccagcacgcgcgcgcgggtgccgacctgctgctggtg
cccagcgccttcacctataccaccggccgggcccactgggaggtgctgctgcgtgcgcgc
gccgtggagaacctggcctatgtgctggcgccggcgcagggcggaacgcacgagaacggc
cggcgcacctggggccacagcatgctggtggacccctggggcagcgtgctggcccagcag
cccgagggcgcgggcgtggtcctgggtacgctggatgcggcgcatctgcgccaggtgcgg
cgccagctgccggcgcttgagcattgcgtgctctga

DBGET integrated database retrieval system