KEGG   Acidovorax sp. JS42: Ajs_4131Help
Entry
Ajs_4131          CDS       T00455                                 

Definition
(GenBank) 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family
  KO
K03270  3-deoxy-D-manno-octulosonate 8-phosphate phosphatase (KDO 8-P phosphatase) [EC:3.1.3.45]
Organism
ajs  Acidovorax sp. JS42
Pathway
ajs00540  Lipopolysaccharide biosynthesis
ajs01100  Metabolic pathways
Module
ajs_M00063  CMP-KDO biosynthesis
Brite
KEGG Orthology (KO) [BR:ajs00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    Ajs_4131
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:ajs01005]
    Ajs_4131
Enzymes [BR:ajs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.45  3-deoxy-manno-octulosonate-8-phosphatase
     Ajs_4131
Lipopolysaccharide biosynthesis proteins [BR:ajs01005]
 Unusual sugar
  Ajs_4131
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_3 Hydrolase HAD Hydrolase_6
Motif
Other DBs
NCBI-ProteinID: ABM44232
UniProt: A1WDA7
Position
complement(4415532..4416110)
Genome map
AA seq 192 aa AA seqDB search
MSQSNATLLPPLQPALQFDPQLLLLAQPVRVAFFDVDGVLTDGGLYFSEVGETLKRFHTL
DGHGIKLLQQAGITPAVVTGRDSPALRLRLKALGVMHARFGTEDKRPAAVSILAELGLSW
PQAAAIGDDWPDLPVMRRVAFACAPAQAHIEARAVAHHVTAAPGGAGAAREFCDLLLVAS
GRYAGLLAAHAA
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgtcccagtccaacgccacgctgctgccccccctgcaaccggccctgcagttcgatccg
caactcctgctgctggcgcagccggtgcgcgtcgccttcttcgacgtggacggtgtgctg
accgacggcggcctgtatttctctgaagtgggcgagaccctcaagcgttttcatacgctt
gacggacacggcatcaagctgctgcagcaggcgggcatcacgcccgcggtggtcacgggg
cgtgattcaccggcgctgcggctgcgcctgaaggcgctgggggtgatgcatgcgcgtttc
ggcaccgaggacaagcgcccggcggccgtgtccatcctggccgagctgggcctgtcgtgg
ccgcaggccgccgccatcggagacgactggcccgacctgccggtgatgcgccgtgtggcc
ttcgcctgtgcgcccgcgcaggcccacatcgaggcccgcgccgtcgcccaccatgtcacc
gccgcgccgggtggcgcgggtgcggcgcgggagttctgcgacctgctgctggtcgccagt
ggccgttacgccggtctgttggccgcgcatgccgcatga

DBGET integrated database retrieval system