KEGG   Acidovorax sp. JS42: Ajs_4167
Entry
Ajs_4167          CDS       T00455                                 
Name
(GenBank) TraG domain protein
  KO
K12056  conjugal transfer mating pair stabilization protein TraG
Organism
ajs  Acidovorax sp. JS42
Brite
KEGG Orthology (KO) [BR:ajs00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ajs02044]
    Ajs_4167
Secretion system [BR:ajs02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Ajs_4167
SSDB
Motif
Pfam: TraG_N
Other DBs
NCBI-ProteinID: ABM44268
Position
pAOVO01:complement(2127..5174)
AA seq 1015 aa
MDIEIQTYWNVETLYYVFNAVASMMAGAGFAGLLKLVFLFAIAIGMFGYMNKQLEMAKWF
IHALAFVTVLNLPIARVALTDKTGLEPPRVVDNVPFALAVTAQTTNLVFGALTNTYETVF
GVPEDLGLQKGDVGFGHRILKQVNNATIRDPSLRSDLMQFIKECTLYDVKDGEITPQQIV
GGTDTWNVIFNNTSPARFVTYNTLTNAPTTDTCTNVAAILKEKVNDAVTAGQAFYGKQAF
TRASSDAIATSMFVSTVGTSYDWILNNSSNASDAMKQAMFNNIWKEAGTELPALLNDPAR
VAEVNALAGAAQAARQADGSNSTLSLLAQETLPHMRNWIEAIIYGLFPVVVVLMVVSSTE
GAKKIIAGYMMSLAWIGLWPILFAVINHLSLMHLRYKARALELAAGVPFQLTDAFDATLT
NEQAAIGYMVVLVPFIAGAIIKLGQGGFMGVADRMMTGFASAGAAVGASNASGNVSMGQA
GLDTASVNTTSMNKYDSNIGLQGGGATIGRGNGSTATMAANGAVALQQLQNRMLTQMNMD
HRLEAGRNQEAHRTDITSTGDQLARRHGDSSSLTDVKGHDTTRGQYQNTGVVAARGSEGG
YGGQHSTGQNLDRNFREGSHFRTAAGANDQLHMNLGVGRGNPSGGGAPGAGGAGGAPDPR
EEKRIADAMKQGGANQQQIDQALKNYRGGKGGAQPSGSLINAGLGYNGAKTYTAEHGRDR
GVDTVHGNQEAARTERTFAERGSRTEQAGTGNQSAQNDRHGRDAALTNVDEVSRVRDVSD
RREFGTGDRANRSDSNSFTTHKDLMADPYLFEKVAARNGMTAMRFANQSEDRIMEMVQDY
VSEKGMVQQATTMPQQTFAGEKLPTTKGELEKQSAKDRAGIPQDIQGVHKKKVAQTGYGG
TAPLKVDTSAPPIIAESRGDVQGQLDPKNKGSIPARAGALDENVNAWASPDKAVGAGRAN
PAAVNEDNMIRDGKDTVQKAWDKLTGGDGTADGEKLNDNMKRETAASVQINNGSK
NT seq 3048 nt   +upstreamnt  +downstreamnt
gtggacatcgaaattcaaacctactggaacgtagaaacgctctactacgtcttcaacgcc
gtggcctcgatgatggccggcgctggcttcgctggcttgctgaagctggttttcctgttc
gccatcgcaatcggcatgttcggctacatgaacaagcagctcgaaatggcgaagtggttt
atccacgccctggcctttgtgaccgtgctcaatctgccgatcgcgcgcgttgccttgacc
gacaagacagggctggagccgccgcgcgtggttgataacgtgccctttgccctggccgtc
actgcgcagacgaccaatctggtgttcggcgcgctgaccaacacctatgaaacggtcttc
ggtgtccctgaagacctgggcctgcaaaaaggggatgtgggcttcgggcaccgcatcctg
aaacaagtcaataacgcgacgatccgcgaccccagcttgcgctccgacctgatgcagttc
atcaaggaatgcacgctgtacgacgtgaaagacggtgaaatcaccccgcagcagattgtg
ggcggcaccgatacctggaacgtgattttcaacaacacgagtccagcccgcttcgtcacc
tacaacaccctgacgaatgcgcctaccaccgatacctgcaccaatgttgcggccatcctg
aaggagaaggtcaacgacgcggtaacggctggccaagccttctacggcaagcaggctttc
acgcgggcaagcagtgatgctatcgctaccagcatgttcgtttcgacggtgggcacgtcc
tacgactggattctgaacaactccagcaacgcctcagacgcgatgaagcaggcgatgttc
aacaacatctggaaggaggccggcaccgagctgccggcgctgctgaacgatcctgcgcgg
gtggccgaggttaatgccctggccggcgctgcccaagcggcgcggcaagcggacggctcc
aacagcaccttgagcctgctggcgcaagagacgctgccccacatgcgcaactggatcgag
gcaatcatctacggtctgttcccggttgttgtggtgctgatggttgtcagctcgaccgag
ggggcaaagaagatcattgcgggctacatgatgtcgctggcctggatcggcctgtggcca
atcttgtttgccgtcatcaaccacctgtcgctcatgcacttgcgctacaaggcgcgcgcg
ctggagctggcggccggtgtgccgttccagctcaccgatgctttcgacgccacgctgacc
aacgagcaggcggccatcggctacatggttgtcctggtgccattcatcgccggggccatc
atcaagctggggcagggcggtttcatgggtgttgccgaccggatgatgaccggctttgcc
tctgccggggcggcggtgggcgcaagcaatgccagcggcaatgtcagcatgggccaagct
ggacttgataccgcatcggtcaacacgacctcgatgaacaagtacgacagcaacatcggc
ctgcaaggcggcggggcaaccatcggtcggggcaatggctcgactgccacgatggccgcg
aacggcgcggttgccttgcagcagctccaaaaccggatgctgacgcagatgaacatggat
caccgactggaagccggccgcaaccaggaagcgcatcgtaccgacatcacatcgaccggg
gatcaactggcgcgccggcacggcgacagctccagcctcacggacgtgaaggggcacgat
acaacccgtggtcaatatcagaatacgggtgtggtggcggctcgcgggagcgagggtggg
tatggtggccagcactcaaccggccagaacttggatcgcaacttccgtgagggttcgcac
ttccgcacggcggccggtgccaatgaccagctccacatgaatttgggtgttggccgtggg
aaccccagcggcggcggtgctcctggtgcgggtggcgcgggtggcgcacctgatccgcgc
gaggaaaagcgtattgccgacgccatgaagcagggcggcgcgaaccagcaacagatcgac
caggcgctgaagaactaccgtggcggcaagggcggtgcccagccctcgggcagtctcatc
aatgcgggcctggggtacaacggcgcgaagacctacaccgccgagcacggccgggatcgt
ggtgtggacacggttcatgggaaccaagaggccgcacgcaccgagcgcacgtttgctgaa
cgcggctcccgcaccgagcaggccgggacgggcaatcaatcggcccaaaacgaccgccac
ggccgcgatgccgccctcacgaatgtggatgaagtttcccgcgtgcgtgatgtctctgat
cgtcgtgagttcggtactggcgaccgggccaaccgtagtgatagcaacagcttcacgact
cacaaggatctgatggccgatccgtacctgttcgagaaggtggctgcgcgcaatggcatg
accgccatgcgtttcgccaaccaatccgaagaccggatcatggaaatggtgcaggactat
gtgagtgagaagggcatggttcagcaggccaccaccatgccgcagcagactttcgcaggc
gaaaaactgccgaccacgaagggtgagctggagaagcaatccgccaaggatcgcgccggc
atcccgcaggacatccagggcgtccacaagaagaaggtggcacagaccggctacggcgga
accgctccgctcaaggtcgatacctctgcgcctccgatcattgcggaatccagaggcgac
gtacaaggccagctcgatccgaagaacaagggcagcatcccggcgcgtgctggagccttg
gacgagaacgtgaatgcctgggccagcccggacaaggccgtgggcgctggacgggccaat
cccgcagccgtcaacgaggacaacatgatccgcgacggcaaggacaccgttcagaaggct
tgggacaagctgactggcggcgacggtacggcagacggcgagaagctgaacgacaacatg
aagcgggaaacggccgcctcagttcagatcaacaacggtagcaagtaa

DBGET integrated database retrieval system