KEGG   Acidovorax sp. JS42: Ajs_4182
Entry
Ajs_4182          CDS       T00455                                 
Name
(GenBank) hypothetical protein
  KO
K12066  conjugal transfer pilus assembly protein TraK
Organism
ajs  Acidovorax sp. JS42
Brite
KEGG Orthology (KO) [BR:ajs00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ajs02044]
    Ajs_4182
Secretion system [BR:ajs02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Ajs_4182
SSDB
Motif
Pfam: TraK
Other DBs
NCBI-ProteinID: ABM44283
Position
pAOVO01:complement(19147..19884)
AA seq 245 aa
MFPRSKKSLSAILLLTSLLATEAGATQVVENADRGHVQVNISVNETNRLAIDGRRIANVV
PSVKGVLAGQKDEALGAYYFTLASESPNQGTVTVFVSDEKGVTYKLILVPRPVAGEEIII
RPPSEKATPSSRAAADGRTVSYQRRIKDLMLVMADDELKDSVETIQVNKEVPLWKEGRLI
LVAKYMDGEVVGEKYRLTNVSPSEMLLVEQELYRRGVRAIAVEHHTLMQGDGTDIYIVRE
RKDNE
NT seq 738 nt   +upstreamnt  +downstreamnt
atgtttccaagatcgaagaaatcgttaagcgcgatccttctgctaacaagcctgctggca
actgaagcaggcgcaacgcaagtcgttgagaacgctgaccggggccacgttcaagtcaat
atctcggtcaacgaaaccaaccgtctcgcaatcgacgggcgccgcattgccaatgtggtg
cccagcgtgaagggcgtgctggcaggccagaaggacgaggccctgggggcttactacttc
acgctggccagcgagtcgcccaaccagggcacggtcacggttttcgtgtccgacgagaag
ggcgttacctacaagctgatcctcgttccgcgtccggtggccggcgaggaaatcatcatc
cggccgccgagcgagaaggctacgccttcgagccgcgcagccgctgatggccgcaccgtc
tcctaccagcgccgcatcaaggacttgatgctggtgatggccgacgacgagctgaaggac
agcgttgaaaccatccaggtgaacaaggaagtgcctttgtggaaagaggggcgcttgatc
ttggtggccaagtacatggatggcgaagtggtgggcgagaaataccgcctgaccaacgtt
tccccctccgaaatgctgctggtcgagcaggagctttaccgccgtggcgtgcgcgccatt
gccgtagagcaccacacgctgatgcagggcgacgggacggacatctacatcgttcgggag
cgcaaagacaatgagtga

DBGET integrated database retrieval system