KEGG   Acidovorax sp. JS42: Ajs_4184
Entry
Ajs_4184          CDS       T00455                                 
Name
(GenBank) TraL
  KO
K12068  conjugal transfer pilus assembly protein TraL
Organism
ajs  Acidovorax sp. JS42
Brite
KEGG Orthology (KO) [BR:ajs00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ajs02044]
    Ajs_4184
Secretion system [BR:ajs02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Ajs_4184
SSDB
Motif
Pfam: TraL
Other DBs
NCBI-ProteinID: ABM44285
Position
pAOVO01:complement(20428..20721)
AA seq 97 aa
MSEKTDLSHYIPRRLDDGAKFLFWEMDVAMIGLMGVLVGIGSGFPVIGLFLGIGAAFFYG
KLKAGKHPGMATHLLYWFTGFPEPKELPGSHIRELNG
NT seq 294 nt   +upstreamnt  +downstreamnt
atgtccgaaaaaacggatctctctcactacatcccgcgccgattggacgacggagccaaa
ttcctcttttgggaaatggacgttgccatgatcggcctcatgggcgtgttggttggcatt
ggctcaggcttcccggtgattgggctgttcctcggtattggagcggcctttttctacggg
aagctgaaggctgggaagcatccgggcatggccacccacctcctgtactggttcaccggg
tttcccgagccgaaagagctgccgggtagccacattcgagaactcaatggatag

DBGET integrated database retrieval system