KEGG   Acidovorax sp. JS42: Ajs_4192
Entry
Ajs_4192          CDS       T00455                                 

Definition
(GenBank) TrwC protein
Organism
ajs  Acidovorax sp. JS42
SSDB
Motif
Pfam: TrwC AAA_30 AAA_19 Viral_helicase1 PIF1 AAA_22 NTPase_1 AAA_16 UvrD_C_2 AAA_33 ABC_tran AAA_18 S-l_SbsC_C NACHT ATP_bind_1
Other DBs
NCBI-ProteinID: ABM44293
UniProt: A1WDG8
Position
pAOVO01:complement(25708..28593)
AA seq 961 aa
MISMNNVGSAGQALHYFSADNYYTQDEGLEHSEWFGKGAEHLGLSGKIDRQAFFEVLNGK
VDGQELGKWVKNEETGEKEREHRPGTDMTFSAPKSVSLMAEVYGKRDVREAHEAAVKKAL
SHIETELARTRQTVDGKTEAVQTGNVTVAMFRHNTSRDLDPQTHTHAVIMNATKREDGQW
RSLTNEEIYNAQRVIGAIYTSELADRLQALGYDIRRTDEKGNFEIAGITREQIEHFSQRR
AEIEAALKAKGVDIDDASAQQKEDATLKTRARKVDVDHEALIGSWKERAKDIGIDFDAIQ
AKADAQRAQGGVVRADKLTGREAMSFAAAHLIEREAVVSKNDLMAAAIEHGAGRVSASEV
KRAFDKLEKDGDLVALPDGNYTTKKMLGSEMWALDQVRAQKGQTPKMMEPEAVAARIAQA
EGRQGFKYSEGQKEAISKVLTTEDRYVAVQGLAGTGKTTMLKGVREMAQEQGYTVRGMAP
TGAASKVLARETGIATDTVSMFQIKERQLQKDIEFAKQYAPDFQRKAEVWIVDESSFLSQ
RQKAQLDHMAEKAGAKVVYLGDTLQLQGVEAGKPFELAQRDGMETAYMTEINRQKTADLK
QAVDIITGRDNLGDGQRLTQVELANNARAFEYMDKAGMIREIPEKSEDDKGRLVAAVVQD
ILKLDKAERERTIVITAYNEDRRAINAGVREGLKEQGELSRSEDTREIYTSKGWTRAMQK
EAQYYKAGDVVRFGRDYQQIDAKKGEYMRVSAVDAPNGTVVLQKEDGSVIAWQPKKHNKI
EVYDRDTRELAKGDLIRITRNEGEFKNGEVARVTAVAGDKVTLELKQGKDVSLHQVDLSR
NKHWDHAYAQTVHASQGATQHRAIFHIRAPQTESEKKQERALENMAKVFGDRSFYVGATR
ASHELRIYTNDKAVAAKAVAAKQDKTSAVETLRQHERATAITADKAGQRPVSPQRNGDVQ
R
NT seq 2886 nt   +upstreamnt  +downstreamnt
atgattagcatgaacaacgtgggcagcgccgggcaggcactgcactacttttccgctgac
aactactacacccaggacgagggcttggagcattccgagtggttcggcaagggggccgag
caccttgggctttccggcaagattgatcgtcaagccttcttcgaggtgttgaacggaaag
gtggatggccaagagctgggcaagtgggtcaagaacgaggaaaccggcgagaaggaacgc
gagcaccggccgggcaccgacatgacgttttccgcgcccaagagtgtttctctcatggcc
gaggtgtacggcaagcgggacgtgcgggaggctcatgaggcggccgtcaagaaggcactc
agccacatcgaaaccgagctggccaggacgcggcaaaccgtggacgggaagaccgaagcg
gtgcagaccggcaacgtgactgtggccatgttccggcataacacaagccgcgacctcgac
ccgcagacgcatacgcacgcagtaatcatgaacgccaccaaacgggaggatgggcagtgg
cgctccctgaccaatgaagaaatctacaacgcgcagcgcgttatcggggccatctacacg
tccgagctggccgaccggctccaggcgctgggctacgacattcgccgcaccgacgagaag
ggcaacttcgagattgccggtatcacccgcgagcagatcgagcacttcagccagcgccgg
gcagaaatagaggcggcgctgaaagccaagggcgtggacatcgacgatgccagcgcgcag
cagaaggaagacgccacgctgaagaccagagcgcgcaaggtggacgtggatcatgaagcc
ttgatcgggagctggaaggaacgagccaaagacatcgggatcgacttcgacgccatccag
gccaaggccgacgcgcaacgggcgcaaggcggtgtggtgcgcgctgacaagctcaccggg
cgcgaggcgatgtcctttgcggccgcacacctgatcgagcgcgaggccgtggtatccaag
aacgacctcatggcggcggccatcgagcacggggcagggcgcgtatcggcatcggaggtg
aaacgggccttcgacaagctggagaaggatggtgatctggtggccttgcctgacggcaac
tacacgaccaagaagatgctgggcagcgaaatgtgggcactcgaccaagtgcgcgcacag
aagggccagacgccgaagatgatggagccggaagcggtggcagcgcggatcgcgcaggcc
gagggccggcagggcttcaaatacagcgaaggccagaaggaggccatcagcaaggtactg
accactgaagatcgttacgtggcggtgcagggccttgccgggacgggtaagaccactatg
ctcaaaggcgtgcgcgaaatggcgcaggagcagggctacacggtgcgcggcatggctccg
accggggcggccagcaaggtgctggccagggagacaggtattgctactgataccgtctcg
atgttccagatcaaggagcggcagctacagaaggacatcgagtttgccaagcagtacgca
cccgacttccagcgcaaggcggaagtctggatcgtggatgaatcgtccttcctgtcgcag
cgccagaaggcccagctcgaccacatggccgaaaaggccggggccaaggtggtgtacctg
ggcgacacgctccagttgcagggtgtggaggccggcaagcccttcgagctggcccagcgg
gacggcatggaaaccgcgtacatgaccgaaatcaaccgccagaagaccgccgacctgaag
caagccgtggacatcatcactggccgcgacaacctgggggacggccagcggctcacccaa
gtggagctggccaacaacgcgcgggccttcgagtacatggacaaggctggaatgatccgg
gaaattcccgagaagtccgaggacgacaagggccgcctggtggcggccgtagtgcaggac
atcttgaagctcgacaaggccgagcgtgagcgaaccatcgtcattaccgcctataacgaa
gacaggcgggccatcaatgccggcgtgcgcgagggactgaaggaacagggcgaactgtcg
cgctccgaggacacgcgcgaaatctacacctcgaaggggtggacgcgggccatgcagaag
gaggcgcaatactacaaggccggcgacgtggtgcgcttcgggcgggactaccagcagatc
gacgccaagaagggcgaatacatgcgcgtgtcggccgtggatgcccccaatggcactgtg
gtgctccagaaggaagacggctctgtgatcgcatggcagccgaagaagcacaacaaaatc
gaggtgtacgaccgcgacacccgcgagctggccaagggcgacctgatccgtatcacccga
aacgaaggcgagttcaaaaacggcgaggtggcgcgcgtcacggctgtggccggggacaag
gtgacgctggagctgaagcaaggcaaggacgtgtcattgcaccaagtggatctctctcga
aacaagcattgggatcatgcctacgcgcagacggttcacgcctcccagggtgcgactcag
caccgggccatcttccacatccgagcgcctcagaccgagagcgagaagaagcaggagcgg
gcgctggagaatatggccaaggtcttcggggatcggagcttctatgtcggggccacgcgc
gcctcgcatgagctgcgcatctacaccaacgacaaggcggtggcggccaaggcggtggcg
gcgaagcaagacaagaccagtgccgtggaaacgctccggcaacacgaacgggccacggca
atcacggccgacaaggcgggacaacgcccggtgtcgccgcagcgaaacggtgacgttcaa
cggtaa

DBGET integrated database retrieval system