KEGG   Acidovorax sp. JS42: Ajs_4194
Entry
Ajs_4194          CDS       T00455                                 
Name
(GenBank) TraD
Organism
ajs  Acidovorax sp. JS42
SSDB
Motif
Pfam: TrwB_AAD_bind TraG-D_C T4SS-DNA_transf AAA_10 DUF87 Phage_holin_3_6 AAA_30
Other DBs
NCBI-ProteinID: ABM44295
Position
pAOVO01:complement(29057..31054)
AA seq 665 aa
MAKREEKGSAGSFSRGAELWMHQARLFVVAIWTVVLISILAGLAVTTAYFWNATTADEKY
ALERNVLAHTRDALYMTAGKMELNVNGELRKMEVSEVALLTDEMAEDAWRKLRNGGMFGL
LTSIGVVFLISLYWWGYGRERMQDNQLRGAKLVEGKELARLIRHRDEASPYEIAGVPMRV
KSETLHTLFAGAQGTGKSQQFFALMKQVRARGKRMIVYDPTGEFTQAFYREGKDILMNPL
DSRSPNWNIWNEIAKDYHFDNMANGLIPDPAESDPFWALAGRMVLKDVIAVLGREGRRTN
RDLYNAIAKSNLDAMHALLQGTAGATYVDPTTERTGMSLKMTVQNQLEAFRFLPDEGESF
SIRKWVHEEGDSWMFITAREAMREALKPVLSLWIDTAIKAVLDLEPIHRERLWFCIDELP
TLQKLDILKLALTNTRKYGLCMVLGVQDFSQLYEIYGHDLAKTIISGCQTKLLLRVTDGA
AAKLLAELMGQAEVDEKDETLSYGLSSQRDGVSVMARRQMRDLVLTSEILTLPDMTGYLL
VPGDYPIARVKYGYVPTEKQANGFIERDGFAISFKPTTAAAAPAPAPSAAEVQQPAAPEQ
GDMLDDDDMDAPATVEVMRNENGDVIDKATGEIIKPAEKVSRAKDDADAKSAGQGKKPNP
LADAL
NT seq 1998 nt   +upstreamnt  +downstreamnt
atggcaaagagagaggaaaagggaagcgccggtagcttctcccgtggggccgagttgtgg
atgcaccaagcccggctgttcgtggtggccatctggacggttgtgctgatttccatcttg
gccggtctggcagtcacgaccgcgtacttctggaatgcgactaccgcagacgaaaagtac
gcgctggagcggaacgtcttggcgcacacgcgggatgcgctctacatgacggccggaaag
atggagctgaacgtcaacggcgagctgcgcaagatggaagtttccgaggttgccttgctg
accgacgagatggccgaggatgcttggcgaaagctgcgcaacggcggcatgttcggcttg
ctgacttccatcggtgtggtgtttctgatctctttgtactggtggggctatggccgtgaa
cgtatgcaggacaaccaactgcgcggggccaagctggtggaaggaaaggagcttgcgcga
ctgatccgacaccgcgacgaggcaagcccttatgagattgcgggcgtgcccatgcgcgtg
aagtcagagacgctgcatacgctgtttgccggcgcgcagggtacgggtaagtcacagcag
tttttcgcactcatgaaacaggtgcgggcgcgtggcaagcggatgatcgtgtatgacccg
accggcgagttcacccaggcgttctaccgtgaaggcaaagacatcctgatgaacccgctg
gactccagaagcccgaactggaacatctggaacgaaatcgccaaggactaccacttcgac
aacatggcgaacggcctgatccccgatccggccgagtccgatccattttgggcgcttgcg
ggccggatggtgctaaaggacgtgattgcagtattggggcgcgagggccgccgcacgaac
cgcgacctctacaacgctatcgccaagagcaacctggacgccatgcacgcattgttgcag
gggacagcgggcgcaacctatgttgatcccacgaccgagcgcacggggatgtcactcaag
atgactgttcagaaccagcttgaagccttccggtttttgccagatgagggcgaatcgttc
tccatccgaaaatgggtacatgaagaaggcgattcatggatgttcatcacagcacgggaa
gcgatgcgcgaggcattgaagcccgttctgtcgttgtggatcgacacggcaatcaaggcc
gtgcttgacttggagccgatccaccgcgagcggctttggttttgcattgacgagctgccg
acactccaaaaactcgacatcctgaagctggctctgacgaacacacggaagtacggtttg
tgcatggtgctgggcgtgcaggacttcagccagctctacgaaatctacgggcacgatctg
gccaagacgatcatttccgggtgccaaacgaagctgctgctgcgtgtgacggatggagct
gcggcgaagctgttggccgaattgatgggacaggccgaggtggatgaaaaggatgaaacc
ttgagctacggcctcagctcgcagcgtgacggcgtgagcgtgatggcgcgccgacagatg
cgcgaccttgtgctgacatcggagattttgacgttgcccgatatgaccggctatctgctg
gttccgggcgactatcccattgcccgcgtcaagtatggttacgtgccgacagagaaacag
gccaacggcttcatcgagcgcgacggctttgcgatcagcttcaagccgaccacggcggcc
gcagcgccggcacccgctccgtccgccgctgaagttcagcagccggccgcgccggagcag
ggcgacatgttggatgacgacgatatggacgcgccggctacggtggaggttatgcgcaac
gaaaatggcgatgtgatcgacaaggcaaccggcgaaatcatcaagccagccgagaaggtt
tcgcgcgcgaaagatgatgcagatgcgaaatcagccggccagggcaagaagcccaacccg
ctggcggatgcgctatag

DBGET integrated database retrieval system