KEGG   Acidovorax sp. JS42: Ajs_4264Help
Entry
Ajs_4264          CDS       T00455                                 

Definition
(GenBank) TrbL/VirB6 plasmid conjugal transfer protein
  KO
K07344  type IV secretion system protein TrbL
Organism
ajs  Acidovorax sp. JS42
Pathway
ajs02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:ajs00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Ajs_4264
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ajs02044]
    Ajs_4264
Secretion system [BR:ajs02044]
 Type IV secretion system
  Trb secretion system protein
   Ajs_4264
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrbL
Motif
Other DBs
NCBI-ProteinID: ABM44363
UniProt: A1WDN8
Position
pAOVO02:complement(13139..14872)
Genome map
AA seq 577 aa AA seqDB search
MRMPANLKTLALPLFVWLAFFAVDAHAAIDNAGVFDSVLDRYQAAASGWAGVITTAATWL
FWTLVVISMVWTFGMMALRKADIGEFFAEFVRFTIFTGFFWWALTNGPNFASSIYASLRQ
LAGNATGLGNALSPSGIVDVGFAIFDKVMDQSSVWSPVDSMAGILMAVAILVILALVGVN
MLLLLASGWVLAYGGVFFLGFGGSRWTSDMAINYYKVVLGVAAQLFAMVLLVGIGKTFLD
DYYARMSAGISLKEMGVMLIVVIILLALTNKIPPLIAGIITGASVGGAGIGQFGAGAALG
AAGMAAAAAATGGAALAAGAASAAGGASAVMAAFSKANENVSAGTDVMSAFSGGGSSGGG
SGGGGGDAGTGGTPFAQAAGFSGGSGGGSSSGGGSTSTGSSSGSSKGGEKGGDKAGAGGQ
GSGSTASTGNGADKAAKNEPKPAGGAGQGQQGGQQAAPGSTGPGLLASAASALGTAGRIA
ADAGANLAKGTADVAKAKAASLREAAAERIADTTGGKIAAAIKAQGSGTAENIDVPDQQP
APSFGDNSLAGGPADADPESEVAAFANREQGRDGTTA
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atgagaatgccagccaatctaaaaaccctcgccctgccgctgttcgtctggctggcgttc
ttcgcggtcgatgcccacgcggccatcgacaacgccggcgtgttcgatagcgtgctggat
cgctaccaggccgccgcgagcggctgggccggtgtcatcaccacggccgcaacctggctc
ttctggacgctggttgtgatctcgatggtctggacgttcggcatgatggccttgcgcaag
gccgacattggcgagttcttcgcggagttcgtccgcttcacgatctttaccggcttcttc
tggtgggcgctgaccaacggccctaacttcgcatcgtccatctatgcgtcgttgcggcag
ctcgccggcaacgcgacgggcctgggcaatgcgctatcgccctcgggcatcgtggacgtg
ggctttgcgatcttcgacaaggtgatggatcagtcctcggtgtggtcgccggtggacagc
atggccggcatcctcatggccgtggcgatcctggtcatcctggccctggtcggcgtcaac
atgctcctgctgctcgcgtcgggctgggtgctggcctacggcggcgtgttcttcctcggc
ttcggtggttcgcgttggacttccgacatggcgatcaactactacaaggtcgtcctgggc
gtggccgcgcagctcttcgcaatggtgctcctggtgggcatcggcaagaccttcctcgat
gactactacgcgcgcatgagcgccggcatcagcctcaaggaaatgggcgtgatgctgatc
gtcgtcatcatccttctggcgttgaccaacaagattccgccgctcatcgccgggatcatc
accggcgcgagcgtgggcggtgccggcatcggtcagttcggtgcaggcgctgcgctgggt
gccgcaggcatggcagcagcagcggccgccactggcggcgcagctctggccgccggcgcg
gcctcggccgccggcggtgcctcggccgtcatggccgccttctcgaaggccaatgagaac
gtgtcggcaggcacggacgtgatgtcggccttctctggtggcggcagctcgggcggtggt
tcaggcggtggcggtggcgacgccggcaccggcggcacgcccttcgcgcaggctgcgggc
tttagcggcggctccggtggcggctcgtcgtcgggtggcggtagcacctcgaccggcagc
agctcgggcagctcgaagggtggcgagaagggcggcgacaaggccggcgccggcggccag
ggcagcggctcgaccgccagcaccggcaacggtgcggacaaggccgccaagaacgaaccc
aagcccgccggcggggcagggcaggggcagcagggcggccagcaggccgcgccgggcagc
accggccccggcttgctcgcgtcggccgcctcggcgctcggcacggccggccgcatcgcg
gccgacgccggcgcgaacttggcgaagggaaccgccgatgttgccaaggccaaggccgcg
agcctgcgcgaagccgcagccgaacggatcgccgacaccaccggcggaaagatcgccgcc
gcgatcaaggcgcaaggaagcggcacggccgagaacatcgacgtgcccgaccagcagccc
gcgccgagcttcggcgacaacagcctggcaggcggcccagccgatgccgatcccgagtcc
gaagtagccgcgttcgccaaccgcgagcaaggccgcgacggcacaactgcgtaa

DBGET integrated database retrieval system