KEGG   Acidovorax sp. JS42: Ajs_4265
Entry
Ajs_4265          CDS       T00455                                 

Definition
(GenBank) entry exclusion protein TrbK
Organism
ajs  Acidovorax sp. JS42
SSDB
Other DBs
NCBI-ProteinID: ABM44364
UniProt: A1WDN9
Position
pAOVO02:complement(14883..15110)
AA seq 75 aa
MKAIKALSLASAALVAALVAGCDNKPATAPMPEVNDENCKPENIAKIEDKGVQQAFSSLC
LRRGGEFKPSPKREW
NT seq 228 nt   +upstreamnt  +downstreamnt
atgaaagcaatcaaggctctgtccttggcctcggccgccctcgtggcggccttggtcgcc
ggctgcgacaacaagccggccacggcccccatgccggaagtgaacgacgagaactgcaag
cccgagaacatcgccaagatcgaggacaagggcgtccagcaggctttctcgtcgctgtgc
ttgcgtcgtggtggggagttcaagcccagcccgaaacgcgaatggtga

DBGET integrated database retrieval system