KEGG   Acinonyx jubatus (cheetah): 106966712Help
Entry
106966712         CDS       T04657                                 

Gene name
NKTR
Definition
(RefSeq) NK-tumor recognition protein isoform X1
  KO
K12740  NK-tumor recognition protein
Organism
aju  Acinonyx jubatus (cheetah)
Brite
KEGG Orthology (KO) [BR:aju00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:aju03110]
    106966712 (NKTR)
Chaperones and folding catalysts [BR:aju03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    106966712 (NKTR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-GeneID: 106966712
NCBI-ProteinID: XP_026896600
Position
Unknown
AA seq 1463 aa AA seqDB search
MGAQDRPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYK
GSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNG
SQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGVLATKS
SKDVFEKKRKKPTHSEDSDSSSNSSSSSESSSESEIEHERSRRRKHKRRPKVKHSKKRRK
EASSSEEPRNKHIMSPKGYSERSDTNEKRSIDSNAKREKPVVRPEEIPPVPENRFLLRRD
MPLVTVEPEPKIPDVPPIVSDQKPSVSKSGRKIKGRGTIRYHTPPRSRSCSESDDDDSSE
TPPHWKEEMQRLRAYRPPSGEKWSKGDKLSDPCSSRWDERSLSQRSRSWSYNGYYSDLST
ARHSDGHHKKRRKEKKVKHKKKAKKQKHCRRHKQTKKRRIIVPSDIESSKSSTRRMKSSC
DRERRSRSSSLSSHHSSKRDWSKSDKDDQSSSTHSSRDSYRSKSHSQSYSRGSSRSRTPS
KSSSHSRSRSKSRSSSKSGHQRTASKSPKRTASQLSENKPVKTEPLRTTVPQNENVIVQA
VVAENIPVIPLSDSPPPSRWKPGQKPWKPSYERIQEMKAKTTHLLPIQSTYSLANIKDTG
SSSSYHKREKNSESDRSAYSKYSDRSSESSPRSRSRSSRSRSYSRSYTRSRSLASSRSRS
RSPSSRSHSRNKYSDHSRCSRSSSYSSVSSDDRRRAKRKYRSSGKKNNTSSKRHSSSSEK
TLRHKYMKSRDKSCQRKYSESRSSLDYSSDSEQSSVQVTQSAQEKEKQVQKEMNNKQERN
RDEEKSKPEQECPRSKKRALKENLSDHLRNGSKHKRKNYAGSKWDSESNSERDGTKNSKN
VSRPSSDKEEGEATSDSESEFGEIHIKAKSTTKSSASTSLPDGNGAWKSNKQRSSTSDSE
GSYSNSENARRRARKHKHGSKENLKREQTKKAKEKLKGKKDKKHKAPKRKQAFHWQPPLE
FGEEEEEEISEKQVIQEAKEKKQVSENSETLKESIVQTEKSCEEGNLSGKCNTVMIPSDI
DQPTKDDSKLSISPRALNTDENVAASPSNVQHIAEIVSSGVEDVLQTDDNMEICTPDRSS
PAKEASPLGNSRLDTPDINIVLKQDVHTERPEGEELKQESSMSESKTMGDVGKQDGGPTG
IASAAESTVKREVAEKSQIGLLDNKWKPLQGVGNVAAPAATTSSTVEVKALTTAPEMKPQ
GLRIEIKSKNKVRPGSLFDEVRKTARLNRRPRNQESSSDEQTPSRDGDSQSRSPSRSRSK
SETKSRHRTRSVSYSHSRSRSRSSTSSYRSRSYSRSRSRGWYSRGRTRSRSSSYRSYKSH
RTSSRSRSRSSSYDPHSRSSRSYTYDSYYSRSRSRSRSQRSDSYHRGRSYSRRSRSCRSY
GSDSESDRSYSHHRSPSESSTYS
NT seq 4392 nt NT seq  +upstreamnt  +downstreamnt
atgggggcgcaggaccggccgcagtgccacttcgacatcgagatcaaccgggagccggtt
ggtcgcattatgtttcagctgttctcagacatatgtccaaaaacatgcaaaaacttcctt
tgcctatgctcaggagagaaaggccttgggaaaacaactgggaagaagttatgttataaa
ggttccacattccatcgtgtggttaaaaactttatgattcagggtggggacttcagcgaa
ggtaatggaaaaggtggagaatcaatttatggtggatattttaaagatgaaaactttatt
ctcaaacatgacagagcgttccttttgtcaatggcaaatcgagggaaacataccaatggt
tcccagtttttcattactaccaaacctgctccacacttggatggggtgcatgtcgtcttt
ggattggttatttctggttttgaagtaattgaacagattgaaaatctgaaaaccgatgct
gcaagcagaccttatgcagatgtgcgagtaattgactgtggggtgcttgccacaaaatca
tcaaaagatgtttttgagaaaaaaaggaagaaaccaactcattcagaagactcggattct
tcttccaattcctcttcctcttcagaatcttcttcagaaagtgaaattgaacatgagaga
agcagaaggaggaaacataagaggaggccaaaagttaagcattctaaaaagagacgaaag
gaagcaagcagttctgaagagccaaggaataaacatataatgagcccaaaaggttactct
gagaggagtgataccaatgaaaaaaggtcaattgattcaaatgctaaaagggaaaagcct
gtggtccgaccagaagagattcccccagttccagagaaccgatttttactgagaagagat
atgcctcttgtcacagtggaacctgaaccgaagattcctgatgttccacccattgtaagt
gatcagaaaccatctgtatcaaaatctggacggaagattaaaggaaggggtacaattcgc
tatcacacacctccaagatcaagatcatgttctgaatcagatgatgatgatagcagtgaa
actcctcctcactggaaagaggaaatgcagagattaagagcatacagaccacctagtgga
gaaaaatggagtaaaggagacaaattaagtgacccctgttcaagccgatgggatgagaga
agcttgtcccagagatccagatcatggtcctataatggatattattcagaccttagtacg
gcaagacactctgatggtcaccataaaaaacgcagaaaagagaaaaaagtgaagcataaa
aagaaagcgaaaaagcagaaacactgcagaagacacaagcagactaagaagagaaggatt
attgtaccatctgacatagaatcctcaaaatcttccacccgacgaatgaaatcctcttgt
gatagagaaaggagatctcgttcttcctcattatcgtctcatcactcatcaaagagggac
tggtctaaatctgataaggatgaccagagctcttcaacccattccagcagggactcctac
agatctaaatctcactcacagtcttactctagaggaagctcaagatcaaggactccatca
aaatcctcatcacattctcgaagtagatcaaagtccagatctagttccaagtcagggcac
caaaggacagcatcaaaatcaccaaaaagaacagcctctcagttaagtgaaaacaaaccg
gttaaaacagaacctttaagaacaacagtgccacaaaatgaaaatgtcatagtacaagcg
gtggtggcagaaaatattcctgtaataccactgagtgacagtccccctccttcaaggtgg
aagcctggacagaagccctggaagccctcttatgaacgaattcaggaaatgaaagctaaa
acaacccacttgctgcccatccaaagcacttacagtttagcaaatattaaagacactgga
agttcatcatcctaccacaaaagagaaaaaaattcagaaagtgatcggagtgcttattca
aaatacagtgacagaagttcagaaagctcaccaaggtcaaggagcagatcttctaggagt
agatcttattccagatcatacacaaggtcacgaagtctagctagttcacgttcgaggtct
aggtctccctcatctagatctcattcacgaaataaatacagtgatcattcacggtgtagt
agatcatcgtcgtactcttctgttagcagtgatgatagaagacgagccaagagaaaatac
agatccagcgggaagaaaaataacacttctagtaaaaggcacagcagcagttccgaaaag
acacttcgccataaatatatgaaaagcagggacaagtcttgtcagagaaagtatagcgaa
agcaggtcatctttagattattcttcagacagtgaacagtcaagtgttcaggttacacag
tcagcccaggagaaagagaagcaagtccaaaaggaaatgaataataagcaagagagaaac
agagatgaagagaaatccaagcccgaacaagaatgccctcgttcaaaaaaaagagccttg
aaagagaatctttctgatcaccttagaaatggcagtaagcacaaaagaaagaattatgcg
ggaagtaaatgggactccgaatcaaactccgaacgagatggaactaaaaacagtaaaaat
gtttcccggccatcttctgataaggaggaaggtgaagctacatcagattctgagtcagag
tttggtgaaattcacatcaaagccaaatccacaacaaagtcttcagcaagtacttcactg
cctgatggtaatggtgcttggaagtcaaataaacagcggtcttcaacctctgattctgag
gggtcctattccaattcagaaaacgctagaagaagggcacggaagcacaaacacgggtca
aaggaaaatcttaaaagggaacagaccaaaaaagcgaaagagaaattgaaagggaaaaaa
gacaaaaagcacaaggctccaaaacgaaaacaagcatttcattggcagcctccactagaa
tttggtgaggaagaggaagaggagattagtgaaaagcaagttattcaggaggcaaaagag
aaaaaacaagtttctgaaaacagtgaaaccttgaaagaaagtattgtgcaaactgagaag
tcctgtgaagagggcaacctttcaggtaaatgtaatacagtaatgattccatcagatatt
gatcagcctactaaagatgatagtaaactcagcatttctcctagagctttaaatactgat
gaaaatgtagctgcttctccctcaaacgttcagcatattgcagaaattgtctcaagtgga
gtggaagatgtgcttcagacagatgacaacatggagatttgcactcctgataggagttcc
ccagcaaaggaggcatcccctctaggaaactcaaggctcgacaccccagatataaacatt
gttttaaagcaggatgtgcacacggagcgtcctgagggagaggagctaaagcaggaaagc
agcatgtctgaaagcaaaacaatgggggacgtgggcaaacaggacggcggccccactggc
attgccagtgctgcagaaagcactgtgaagagagaggtggctgagaagagccagatcggt
ctcttagataataaatggaagcccctgcaaggtgtggggaacgtggccgccccggctgct
actacatccagcactgtggaagtgaaggcattgactactgcacctgagatgaagccacaa
ggcttgaggatagaaatcaaaagcaaaaataaagtccggcctgggtctctctttgatgaa
gtaagaaagacagcacgcttaaaccggaggccaagaaatcaggagagttcaagtgatgag
cagacacctagtcgagatggggatagccagtccaggagtccaagcagatctcgaagtaaa
tctgaaaccaaatcaagacacagaacaaggtctgtctcctacagtcactcaagaagtcga
tcacgaagttccacatcgtcttatcgatcaagaagctactctagaagtcggagcagagga
tggtacagcagaggccgcacaagaagccggagcagctcctaccgcagttacaaaagtcac
aggacatccagcaggagcagatccaggagcagctcgtacgacccccacagtcggtccagc
aggtcctacacttacgatagctactatagcaggagtcggagtcgaagtaggagccaaagg
agtgacagttaccaccgaggcagaagttacagcaggcggtccaggagttgtagatcttat
ggctctgacagtgaaagtgaccgaagttactctcatcaccggagccccagtgaaagcagc
acatatagttga

DBGET integrated database retrieval system