KEGG   Acinonyx jubatus (cheetah): 106967543Help
Entry
106967543         CDS       T04657                                 

Gene name
CAMKK2
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase kinase 2 isoform X1
  KO
K07359  calcium/calmodulin-dependent protein kinase kinase 2 [EC:2.7.11.17]
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04140  Autophagy - animal
aju04152  AMPK signaling pathway
aju04211  Longevity regulating pathway
aju04920  Adipocytokine signaling pathway
aju04921  Oxytocin signaling pathway
aju05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    106967543 (CAMKK2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106967543 (CAMKK2)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    106967543 (CAMKK2)
   04921 Oxytocin signaling pathway
    106967543 (CAMKK2)
  09149 Aging
   04211 Longevity regulating pathway
    106967543 (CAMKK2)
 09160 Human Diseases
  09165 Substance dependence
   05034 Alcoholism
    106967543 (CAMKK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aju01001]
    106967543 (CAMKK2)
Enzymes [BR:aju01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     106967543 (CAMKK2)
Protein kinases [BR:aju01001]
 Serine/threonine kinases: Other
  CAMKK family
   106967543 (CAMKK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 106967543
NCBI-ProteinID: XP_026900119
Position
Unknown
AA seq 580 aa AA seqDB search
MSSCVSSQPSSDRAALQDELGGGGSSGSEGQKPCEALQGLSTLSIRLGMESFIVVTECEP
GCAVDRGLARDRPLEADGQEVPLHASASGSQARPQLCGRKLSLQERSQLDANGRCVHPAL
SHSPVGSPQSSPRLPRRPTVESHHVSITGMQDCVQLNQYTLKDEIGKGSYGVVKLAYNEN
DNTYYAMKVLSKKKLIRQAGFPRRPPPRGTRPAPGGCIQPRGPIEQVYQEIAILKKLDHP
NVVKLVEVLDDPNEDHLYMVFELVNQGPVMEVPTLKPLSEDQARFYFQDLIKGIEYLHYQ
KIIHRDIKPSNLLVGEDGHIKIADFGVSNEFKGSDALLSNTVGTPAFMAPESLSETRKIF
SGKALDVWAMGVTLYCFVFGQCPFMDERIMCLHSKIKSQALEFPDQPDIAEDLKDLITRM
LDKNPESRIVVPEIKLHPWVTRHGAEPLPSEDENCTLVEVTEEEVENSVKHIPSLATVIL
VKTMIRKRSFGNPFEGSRREERSLSAPGNLLTKKPTRECEPLSEPKEARQRRQPPGPRPA
PRGGGGSALVKGGPRAESWGAPAPGPRARMHPLRPDEAME
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcatgcgtctctagccagcccagcagcgaccgggccgccctccaggatgagctg
gggggcgggggcagcagcggcagcgaaggccagaagccctgtgaggccctgcagggcctc
tcgaccctgagcatccgcctgggcatggagtccttcatcgtggtcaccgagtgtgagccg
ggctgcgcggtggaccgcggcctggcccgggaccggcccctggaggccgatggccaagaa
gtacccctccatgcctccgcctccgggtcccaggcccggccccagctctgcggtcgcaag
ctctctctgcaggagcggtcccagctggatgcgaatggacgctgcgtccacccggctctg
tcccactcgcccgtgggctccccgcagtcgtcgccgaggctgccccggcggcccacggtg
gagtcccaccacgtctccatcactggcatgcaggattgtgtacagctgaatcagtacaca
ctgaaggatgaaattggaaagggctcctatggcgtggtcaagttggcctacaatgaaaat
gacaatacctattatgcgatgaaggtgttgtcgaaaaagaagctgatccgacaggcaggc
tttccacgtcgccccccgccccgaggcacccggccagctccgggaggctgcatccagcct
aggggccccattgagcaggtgtaccaggaaatcgccatcctcaagaagctggaccacccc
aatgtggtaaagctggtagaggtcctggatgaccccaacgaggaccatctgtacatggtg
tttgagctggtcaaccaagggcctgtgatggaagtgcccacccttaaaccactctctgag
gaccaggcccgtttctacttccaggacctgatcaaaggcatagagtacctacactaccag
aagatcatccaccgggacatcaaaccttccaacctgctggtgggagaagatggccacatc
aagattgccgacttcggcgtgagcaacgagttcaagggcagtgatgcgcttctctctaac
accgtgggcacacctgccttcatggcgcctgagtcgctctcagagacccggaagatcttc
tctgggaaggctttggatgtttgggccatgggtgtgacgctgtactgctttgtgtttggc
cagtgcccgttcatggacgagcggatcatgtgtttacacagtaagatcaagagtcaggcc
ctggagtttccagatcagcctgacatagctgaggacttgaaggacctgataacccgcatg
ttggacaagaacccagaatcaaggattgtggtgccagaaatcaagctgcacccctgggtc
acgaggcacggggcggagccgttgccatcggaggacgagaactgcacgctggtcgaggtg
accgaagaggaggtcgagaattcggtcaaacacattcccagcctggcgactgtgatcctg
gtgaagaccatgatacggaaacgctcctttgggaacccgtttgagggcagccggcgggag
gagcgctcattgtcagcgcctggaaacctgcttaccaaaaaaccaaccagggagtgtgag
cccctgtctgagcccaaggaagcaaggcagcgaagacagcctccggggccccgacccgcc
ccccgtgggggaggaggaagtgctcttgtgaaaggcggtccccgcgccgagagttggggg
gccccggcccccggcccccgcgcacgcatgcatcctctgcggcccgacgaggcgatggag
tag

DBGET integrated database retrieval system