KEGG   Acinonyx jubatus (cheetah): 106967633Help
Entry
106967633         CDS       T04657                                 

Gene name
MRPL22
Definition
(RefSeq) 39S ribosomal protein L22, mitochondrial isoform X1
  KO
K02890  large subunit ribosomal protein L22
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju03010  Ribosome
Brite
KEGG Orthology (KO) [BR:aju00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    106967633 (MRPL22)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:aju03011]
    106967633 (MRPL22)
Ribosome [BR:aju03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    106967633 (MRPL22)
  Bacteria
    106967633 (MRPL22)
  Archaea
    106967633 (MRPL22)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-GeneID: 106967633
NCBI-ProteinID: XP_014919388
Position
Unknown
AA seq 210 aa AA seqDB search
MAAAALERLGALWMQNLRGKLALGLLSSHSVLPQSHIHTTVSLDVSRKWEKKNKIVYPPQ
LPGEPRRPAEIYHCRRQIKYSKDKMWYLAKLIRGMSIDQALAQLEFSDKKGAQIIKEILL
EAQDMAVRDHNVEFRSNLYIAESTSGRGQYLKRIRYHGRGRFGIMEKVYCHYFVKLVEGP
PPPREAPKTAVTHAKEYIQELRNRTIIHTL
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcagcactggaacgtttaggtgcattatggatgcagaatctgagggggaag
ctggccttaggacttctttcatctcacagcgttttaccccagtcacatatccacacaact
gtatctctggacgtatctcgaaaatgggaaaagaagaataaaattgtgtatcctccacaa
ttgcctggtgaacctcggcgaccagcagaaatctaccattgtcgaaggcaaataaaatac
agcaaagacaagatgtggtatttggcaaaattgatacgaggaatgtccattgaccaggct
ttggctcaattggaattcagtgacaaaaaaggggcccagataattaaagagattctctta
gaagcacaagatatggcagtgagagaccacaatgtggaattcagatccaatttatatata
gctgagtcaacctcagggcgaggccagtacctgaaacgcatccgataccatggcagaggt
cgctttgggatcatggagaaggtttattgccattattttgtgaagttggtggaaggccct
ccacctccacgtgaggcaccgaagacggcagtcacccatgccaaggagtatattcaggag
cttcgtaaccggaccattattcacactctgtga

DBGET integrated database retrieval system