KEGG   Acinonyx jubatus (cheetah): 106967642Help
Entry
106967642         CDS       T04657                                 

Gene name
GRIA1
Definition
(RefSeq) glutamate receptor 1 isoform X1
  KO
K05197  glutamate receptor 1
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04024  cAMP signaling pathway
aju04080  Neuroactive ligand-receptor interaction
aju04713  Circadian entrainment
aju04720  Long-term potentiation
aju04723  Retrograde endocannabinoid signaling
aju04724  Glutamatergic synapse
aju04728  Dopaminergic synapse
aju04730  Long-term depression
aju05014  Amyotrophic lateral sclerosis (ALS)
aju05031  Amphetamine addiction
aju05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    106967642 (GRIA1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    106967642 (GRIA1)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    106967642 (GRIA1)
   04728 Dopaminergic synapse
    106967642 (GRIA1)
   04720 Long-term potentiation
    106967642 (GRIA1)
   04730 Long-term depression
    106967642 (GRIA1)
   04723 Retrograde endocannabinoid signaling
    106967642 (GRIA1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    106967642 (GRIA1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    106967642 (GRIA1)
  09165 Substance dependence
   05031 Amphetamine addiction
    106967642 (GRIA1)
   05033 Nicotine addiction
    106967642 (GRIA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:aju04040]
    106967642 (GRIA1)
Ion channels [BR:aju04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   106967642 (GRIA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANF_receptor Lig_chan Lig_chan-Glu_bd SBP_bac_3 DUF659 Peripla_BP_6
Motif
Other DBs
NCBI-GeneID: 106967642
NCBI-ProteinID: XP_026933323
Position
Unknown
AA seq 906 aa AA seqDB search
MQHIFAFFCTGFLGAVVGANFPNNIQIGGLFPNQQSQEHAAFRFALSQLTEPPKLLPQID
IVNISDSFEMTYRFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPSFPVDTSNQ
FVLQLRPELQDALISIIDHYKWQKFVYIYDADRGLSVLQKVLDTAAEKNWQVTAVNILTT
TEEGYRMLFQDLEKKKERLVVVDCESERLNAILGQIIKLEKNGIGYHYILANLGFMDIDL
NKFKESGANVTGFQLVNYTDTIPAKIMQQWKNSDARDHTRVDWKRPKYTSALTYDGVKVM
AEAFQSLRRQRIDISRRGNAGDCLANPAVPWGQGIDIQRALQQVRFEGLTGNVQFNEKGR
RTNYTLHVIEMKHDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPYV
MLKKNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGE
LVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIW
MCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQ
QGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIA
YGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLES
TMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSALRNPVNLAVLKLNEQGLLDKLKNKW
WYDKGECGSGGGDSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMK
GFCLIPQQSINEAIRTSTLPRNSGAGTSGGGSGENGRVVSHDFPKSMQSIPCMSHSSGMP
LGATGL
NT seq 2721 nt NT seq  +upstreamnt  +downstreamnt
atgcagcacatttttgccttcttctgcaccggtttcctaggcgcggtagtaggtgccaat
ttccccaacaacatccagatcgggggattatttccaaaccagcagtcacaggaacatgcc
gcttttagatttgctttgtcacaactcacagagcccccaaagctgctcccccagattgat
attgtgaacatcagcgacagctttgagatgacctatagattctgttcccagttctctaaa
ggagtctacgccatctttgggttttatgaacggagaactgtcaacatgctgacctccttc
tgtggggccctccacgtctgcttcatcacaccgagcttccccgttgacacctccaatcag
tttgtccttcagctacgccctgagctgcaggatgctcttatcagcatcatcgaccattac
aagtggcagaaattcgtctacatttatgatgccgaccggggtttgtccgtcctgcagaaa
gtactggacacagctgctgagaagaactggcaggtgacagcggtcaacattttgacaacc
acagaggagggataccggatgctctttcaggacctggaaaagaaaaaggagcggctagtg
gtggtggactgtgaatcagaacgtctcaacgctatcttgggccagattatcaagctggag
aagaatggcatcggctaccactacatccttgcaaatctgggtttcatggacattgactta
aacaaattcaaggagagtggagcaaatgtaacaggtttccagttggttaactacacagac
accatcccagccaaaatcatgcagcagtggaagaacagcgatgctcgcgaccacacccgg
gtggactggaagagacctaagtacacctctgcgctcacctacgatggggtgaaggtgatg
gctgaggcttttcagagcctgcggaggcaaagaatcgatatatcccgccgggggaatgct
ggggactgcctggctaacccagcagtgccctggggccaggggatcgacatccaaagagct
ctgcagcaggtgcggtttgaaggcttgacaggaaatgttcaatttaatgagaagggacgc
cggaccaactacaccctccatgtgattgaaatgaagcatgatggcatccgaaagatcggt
tactggaatgaagatgataagtttgtccctgcagccaccgatgctcaagctgggggggac
aattcaagtgtccagaatagaacatacatcgttactacaatcctagaagatccgtatgtg
atgctcaagaagaatgccaaccagtttgagggcaatgaccgctatgagggctactgtgta
gagctggcagcagagattgccaaacatgtgggctactcctaccgtcttgagattgtcagc
gatggaaaatatggagcccgtgaccctgacaccaaggcttggaatggcatggtgggagag
ctggtctatggaagagccgatgtggccgtggctcctttaactatcaccttggtccgggaa
gaggtgatagatttctccaagccatttatgagtttggggatctccatcatgataaaaaag
ccgcagaagtccaagccgggggtcttctccttcctcgatcctttggcttatgaaatttgg
atgtgcattgtctttgcctacattggagtgagtgtcgtccttttcctggtcagccgcttc
agcccctatgaatggcacagtgaagagtttgaggaagggcgggaccagacaaccagtgac
caatccaatgagtttgggatattcaacagtttgtggttctccctgggagcattcatgcaa
caaggatgtgacatttctcccaggtccctgtctggccgcatcgttggtggtgtctggtgg
ttcttcaccttgatcatcatctcctcatacacagccaacctggctgccttcttgaccgtg
gagaggatggtgtctcccatcgagagtgctgaggacctagcgaaacagacggaaatcgct
tacggcacactggaagcagggtccactaaggagttcttcaggaggtctaaaattgccgtg
tttgagaaaatgtggacatacatgaagtcagcagaaccatcagtttttgtgcgaaccaca
gaggaaggaatgatccgagtgaggaaatccaaaggcaaatacgcctaccttctggagtct
accatgaatgaatacattgagcagcggaaaccctgtgacaccatgaaggtgggaggtaac
ttggattccaaaggctatggcattgcgacacccaaggggtccgccctgagaaatccagta
aacctggcagtgttaaaactgaacgagcaggggcttttggacaaattgaaaaacaaatgg
tggtacgacaagggcgagtgcggcagcgggggaggtgattccaaggacaagacaagtgct
ctgagcctcagcaatgtggcaggcgtgttctacatcctgattggaggacttggactagcc
atgctggttgccttaatcgagttctgctacaaatcccgtagcgaatccaagcggatgaag
ggtttctgtttgatcccacagcaatccatcaatgaagccatacggacatcaacactcccg
cgaaacagtggggcaggaaccagcggtggcggcagtggagaaaacggccgggtggtcagc
catgacttccccaagtccatgcagtcgattccctgcatgagccacagttcagggatgccc
ttgggagccacaggattgtaa

DBGET integrated database retrieval system