KEGG   Acinonyx jubatus (cheetah): 106967714
Entry
106967714         CDS       T04657                                 

Gene name
ANKRD53
Definition
(RefSeq) ankyrin repeat domain-containing protein 53
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
aju  Acinonyx jubatus (cheetah)
Brite
KEGG Orthology (KO) [BR:aju00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:aju03036]
    106967714 (ANKRD53)
Chromosome and associated proteins [BR:aju03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    106967714 (ANKRD53)
SSDB
Motif
Pfam: Ank_2 Ank Ank_5 Ank_4 Ank_3
Other DBs
NCBI-GeneID: 106967714
NCBI-ProteinID: XP_014919495
Position
Unknown
AA seq 491 aa
MPPAEKFSHKVSWGGSSPKQPRASGPDRDSAFSLTSSLPTLHLRYNSNPDEWDKRAIGSY
YELYAAALGNLEWLRFCLSRHCEEIPADDKGFTAIHFAAQSGKLACLKVLVEEYKFPVDL
PTNNGQTPLHLAIHKDNKTMILPCIHYLLKQGAALNTQTCNGSTPLHLAACQGLLKCVKV
LVQNGADVHARDAMGCKPIDYCKIWNHRDCARFLKDAMWKRDKKDFACEMGKLKTLKDQL
ALMEQDYLTEYQKEHQILREANFKKWLHCKQLLRGQSLIRTAKREPCTPRQAMALSKATK
YQGLRPPKSFYPSPEARLRETPRPKLQPLRTHTPIYMQPMVRRPKSWNVSNNPARSPTTQ
IGYTQGIRLGVHPDPSSEHDFRSFLKVRSDRHGSAKLCTVAGNQVAPVPQLPFEVMVQEL
YPSVRPYRMKVPQGFCSVSMKDVPQKRHLGDNNFWTDALAMNLRETFDEAFLAAVQAHQR
LPTRPYLKSPP
NT seq 1476 nt   +upstreamnt  +downstreamnt
atgccgccagcggagaaattctcccacaaggtctcctggggtggttcgtcgcccaagcag
cccagggcctccggcccagaccgggactccgctttctcactcacctcctcgcttccaacc
ctccacttgcgctacaactctaacccggatgagtgggacaagagggccatagggagctac
tacgagttgtacgcggcggcgctgggcaacctggaatggttgcggttctgtctgagtcgg
cactgtgaggaaatcccggcagatgacaagggtttcactgccatccacttcgcagcccag
agtggcaagcttgcatgcctgaaggtcttggtagaggagtacaagtttccggtggacctg
cccaccaacaatggtcagacacccctgcacctggccatccacaaggacaacaagaccatg
atcctcccctgcattcactacctgcttaagcaaggggcggccctcaacactcagacgtgc
aatggctccacacccctccacctggcggcctgccagggcctgctgaaatgtgtgaaggtc
ctggtgcaaaatggggccgatgtccatgcccgagatgccatgggctgcaaacccatcgac
tattgcaaaatatggaatcaccgcgactgtgccaggttcttgaaggatgccatgtggaaa
cgggacaagaaggactttgcttgtgagatggggaaattgaagacgctcaaggaccagctg
gccctcatggaacaggactacctgactgagtatcaaaaagagcaccaaattctgagagaa
gctaatttcaagaagtggctccactgcaagcagctgctccgaggccaatccctgatccgg
accgccaagcgagagccttgtaccccacgccaggctatggccctctccaaggccaccaag
taccagggactgaggcctcccaagagcttctacccctccccagaggcgcgcctgcgagag
acaccgcggcccaagctgcagcccttgaggacacacacacccatctacatgcagcccatg
gtcaggcggcccaagtcatggaatgttagcaacaatcctgccagatcacccaccacccag
attggctacacgcagggcatccgcctgggtgtgcatccagaccccagctcagagcatgac
ttccgcagcttcctcaaggtgaggtccgacaggcacggtagtgccaaactgtgcacagtg
gccggcaaccaggtggcacctgtgccccagctgcctttcgaggtgatggtccaagagctg
tacccttcggtgcggccatacaggatgaaagtgccccagggcttttgctctgtcagcatg
aaggatgtgccccagaagcggcacttgggtgataacaacttctggactgacgctctggcc
atgaacctgcgcgagacatttgatgaagccttcctggcagctgtgcaagcccatcaaagg
ctccccactcgaccctacctgaaaagtcccccataa

DBGET integrated database retrieval system