KEGG   Acinonyx jubatus (cheetah): 106967844Help
Entry
106967844         CDS       T04657                                 

Gene name
KHK
Definition
(RefSeq) ketohexokinase isoform X1
  KO
K00846  ketohexokinase [EC:2.7.1.3]
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju00051  Fructose and mannose metabolism
aju01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aju00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106967844 (KHK)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aju04147]
    106967844 (KHK)
Enzymes [BR:aju01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.3  ketohexokinase
     106967844 (KHK)
Exosome [BR:aju04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   106967844 (KHK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PfkB Glyco_hydro_36N
Motif
Other DBs
NCBI-GeneID: 106967844
NCBI-ProteinID: XP_026889204
Position
Unknown
AA seq 343 aa AA seqDB search
MEDKQILCVGLVVLDIINVVDKYPEEDTDSRCLSQRWQRGGNASNSCTVLSLLGAPCAFM
GSLAPGHVADFVLDDLRRYSVDLRYTVFQTTGSVPISTVIINEASGSRTILHAYSFLVAD
FRQRGVDVSQVAWQGRGETPCSCCIVNNCNGSRTIVLYDTNLPDVSAADFDKVDLTRFKW
IHIEGRNASEQVQMLQRIEQHNARQPPGQKIQVSVEVEKPREELFQLFGYGDVVFVSKDV
ARHLGFRSAVEALRGLYGRVRKGAMLVCAWAEEGADALGPDGQLLHSDAFPPPRVVDTLG
AGDTFNASVIFSLSQGKSMQEALRFGCQVAGKKCGLQGFDGIV
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atggaagacaagcagatcctgtgcgtggggctagtggtgctggacatcatcaatgtagtg
gacaagtacccggaggaggacacggacagcaggtgcttgtcccagagatggcagcgtgga
ggcaacgcatctaattcctgcaccgtcctctccctgcttggagccccctgtgccttcatg
ggctcgctggccccgggccatgttgccgattttgtcctggatgacctccgccgctattct
gtggacctacgctacacagtctttcagaccacgggctctgtccccatctccacagtcatc
atcaacgaggccagtggtagccgcaccatcctccatgcctacagcttcctggtggccgac
ttcaggcagcggggcgtggatgtgtctcaggtggcctggcagggcagaggggaaacccca
tgctcttgctgcatcgtcaacaactgcaatggctcccgcaccattgtgctctacgacacg
aacctgccagatgtgtctgctgcggactttgacaaggttgatctgacccggttcaagtgg
atacacatcgagggccggaatgcatcagaacaagtgcagatgctgcagcggatagaacag
cacaatgccaggcagcctcctggtcaaaagatccaagtgtccgtggaagtggagaagccc
cgagaagagctgttccagctgtttggctatggagacgtggtgtttgtcagcaaagatgtg
gccaggcacttggggttccggtcagcagtggaggccctgaggggcttgtatggtcgtgtg
aggaaaggggctatgctagtctgcgcctgggctgaggagggcgctgatgccctgggccct
gacggacagctgcttcactcggatgctttccctccaccccgggtagtggatactctgggg
gccggagacaccttcaacgcctcagtcatattcagcctgtcccaggggaagagtatgcag
gaggctttgagatttggctgccaggtggccggcaagaagtgtggcctgcagggctttgat
ggcattgtgtga

DBGET integrated database retrieval system