KEGG   Acinonyx jubatus (cheetah): 106968512Help
Entry
106968512         CDS       T04657                                 

Gene name
PLA2G4E
Definition
(RefSeq) cytosolic phospholipase A2 epsilon isoform X1
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju00564  Glycerophospholipid metabolism
aju00565  Ether lipid metabolism
aju00590  Arachidonic acid metabolism
aju00591  Linoleic acid metabolism
aju00592  alpha-Linolenic acid metabolism
aju01100  Metabolic pathways
aju04010  MAPK signaling pathway
aju04014  Ras signaling pathway
aju04072  Phospholipase D signaling pathway
aju04217  Necroptosis
aju04270  Vascular smooth muscle contraction
aju04370  VEGF signaling pathway
aju04611  Platelet activation
aju04664  Fc epsilon RI signaling pathway
aju04666  Fc gamma R-mediated phagocytosis
aju04724  Glutamatergic synapse
aju04726  Serotonergic synapse
aju04730  Long-term depression
aju04750  Inflammatory mediator regulation of TRP channels
aju04912  GnRH signaling pathway
aju04913  Ovarian steroidogenesis
aju04921  Oxytocin signaling pathway
aju05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:aju00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    106968512 (PLA2G4E)
   00565 Ether lipid metabolism
    106968512 (PLA2G4E)
   00590 Arachidonic acid metabolism
    106968512 (PLA2G4E)
   00591 Linoleic acid metabolism
    106968512 (PLA2G4E)
   00592 alpha-Linolenic acid metabolism
    106968512 (PLA2G4E)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    106968512 (PLA2G4E)
   04010 MAPK signaling pathway
    106968512 (PLA2G4E)
   04370 VEGF signaling pathway
    106968512 (PLA2G4E)
   04072 Phospholipase D signaling pathway
    106968512 (PLA2G4E)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    106968512 (PLA2G4E)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    106968512 (PLA2G4E)
   04664 Fc epsilon RI signaling pathway
    106968512 (PLA2G4E)
   04666 Fc gamma R-mediated phagocytosis
    106968512 (PLA2G4E)
  09152 Endocrine system
   04912 GnRH signaling pathway
    106968512 (PLA2G4E)
   04913 Ovarian steroidogenesis
    106968512 (PLA2G4E)
   04921 Oxytocin signaling pathway
    106968512 (PLA2G4E)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    106968512 (PLA2G4E)
  09156 Nervous system
   04724 Glutamatergic synapse
    106968512 (PLA2G4E)
   04726 Serotonergic synapse
    106968512 (PLA2G4E)
   04730 Long-term depression
    106968512 (PLA2G4E)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    106968512 (PLA2G4E)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    106968512 (PLA2G4E)
Enzymes [BR:aju01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     106968512 (PLA2G4E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: cPLA2_C2 PLA2_B C2 CEP76-C2
Motif
Other DBs
NCBI-GeneID: 106968512
NCBI-ProteinID: XP_014920381
Position
Unknown
AA seq 862 aa AA seqDB search
MTLQSSEGCPGPGTDVFAPQELQGAEESRSERNVSEFEHTQDLETPSLPPLLPTALGGSQ
DGVSPCHLLTVKVIRMKNVRQADMVSQTDCFVSLWLPTASRERLRTRTISNCPNPEWNET
FSFQIQSQVKNVLELSICDEDTVTPNDHLLTVLYDLTKLCFRKKTHMKFPLNPEGMEELE
VEFLLEESPFPPETLVTNGVLVSRQVSCLEVHAECKRQKKSRKMKDLLVTVKESFEHTQR
VSHCQEPCCPNLACFHYPKYFQPQMHVEVPKSQWSCGPCCCCARKNSPVCQPLDCLPDGQ
VVTLPVGENCELHVKSTPCPQTLDVRLGFSLCQAELEFLQKRKVVVAEALKQVLQLEEDL
HTDEVPLIAIMATGGGTRSMTAMYGHLLGLQKLNILNCASYITGLSGATWTMATLYRDPD
WSSKNLEPAIFEARRHVVKDKMPALFPDQLCKFQEELRQRSQEGYKVTFTDFWGLLIEAC
LGDERNECKLSDQRAALSQGQNPLPIYLTINVKDDVSNQDFREWCEFSPYEVGLQKYGAF
IPTELFGSEFFMGRLMKRIPESRMCYMLGLWSSIFSLNLLDAWNLSHTSEEFFHRWTRDK
VHDIEDEPLLPEIPKCDANILDTAVVIPGSWLSNTFRSILTHRSFVSEFHNFLLGLQLHT
DYLQNSQFSMWRDTVLDTFPNQLTGSVNHLCLLDTAFFVNSSYPPLLRPERKVDLIIHLN
YCAGSQTKPMKQTCEYCSVQNIPFPKYEVQEGDENLKECYLIENSQEPDAPIVIFFPLIN
DTFQKYKAPGVERSPEELEQGHVDIYGPKTPYATKELTYTEAAFDKLVKLSEYNILNNKD
KLFQALRLAVEKKKRLKSQCPS
NT seq 2589 nt NT seq  +upstreamnt  +downstreamnt
atgactctccagagctcggaaggctgtcctggcccgggaactgatgtgtttgccccacag
gagctacagggggctgaagagagcaggtcggaaagaaatgtcagtgagtttgagcacaca
caggacctggaaactcccagtctcccacctctgcttcccacggcccttgggggctctcag
gatggggtctctccatgccacctgctgacagtgaaggtcatccggatgaaaaatgtccgg
caggctgatatggtgagccagacagactgctttgtgagcctttggctgcccaccgcttct
cgtgaaaggctgaggactaggaccatctccaactgcccaaacccagagtggaatgaaacc
ttcagcttccagatccagagccaagtgaagaacgtgctggagctgagcatctgtgatgaa
gacacagtgacaccaaatgaccacctgttgacagtcctctatgacctcaccaagctctgc
ttccgaaagaaaacccatatgaagttcccactcaacccagagggcatggaagagctggag
gtagagttcctgctggaggagagtccctttccacctgagaccctcgtcaccaacggcgtg
ctggtgtctcgacaagtctcctgcctagaggttcatgcagaatgcaagaggcagaagaag
agcaggaaaatgaaggacctcctggtgacagtaaaggagtccttcgagcacacccagcgc
gtctcacactgccaggagccctgctgcccgaacctggcctgcttccactaccccaagtac
ttccagccccagatgcacgtggaagtgcccaagagccagtggagctgtgggccctgctgc
tgctgtgcgcgcaagaacagccctgtctgccagcctctcgattgccttcctgacggccag
gtggtgaccctgccggtgggtgagaactgtgagttacacgtgaagtctacaccctgcccc
cagacgcttgacgtgcggctgggcttcagcctatgccaggcagagctggagtttctgcag
aagcggaaggtggtggtggccgaggcactgaaacaggtgttgcagctggaggaggacctg
catacggacgaggtaccattgatagccatcatggccactgggggtggaacaagatccatg
actgccatgtacggccacctgctggggctgcagaagctgaacatcctgaactgtgccagc
tacatcactggcctgtcaggggctacctggaccatggctaccttgtaccgtgatcctgac
tggtcctccaaaaacctggagccggccatatttgaggcacggaggcatgtggtcaaggac
aagatgcctgccctattcccagaccagctctgcaaattccaggaggagcttcggcagcgc
agtcaggaaggctacaaggtcacctttacagatttctggggccttctgattgaggcctgt
ctgggggatgagagaaatgaatgcaaactgtcagatcagcgtgctgctttatcccagggc
cagaaccccctgcccatctacctcaccatcaatgtcaaggatgatgtaagcaaccaggat
ttcagagagtggtgcgagttctccccctacgaagtgggcctgcagaagtacggcgccttc
atccccactgagctctttggatccgagttcttcatggggaggctgatgaaaaggatccca
gagtcaaggatgtgctacatgctaggtttgtggagcagcatcttctccctgaacttgctc
gatgcctggaatctgtcccatacctcagaggagtttttccacaggtggacgagggataaa
gtgcacgacatcgaagatgagccactcctgcctgaaatccccaaatgtgatgccaacatc
ttggacaccgcagtggtgatcccagggtcctggttgtccaatactttccgcagcatcctc
acccataggtccttcgtgtctgagttccacaacttcctgttggggctgcagctgcacacc
gactacctccagaacagccagttctccatgtggagagacacggtgctagatactttcccg
aaccagctgacggggtccgtgaaccatttgtgcctgttggacactgcattctttgtcaat
tccagctacccgcccctccttaggcctgagagaaaagttgacctcatcatccacctcaat
tactgtgctgggtcccagacaaagcccatgaaacaaacctgtgagtactgctctgtgcag
aatatccccttccccaaatacgaagtgcaagagggggacgaaaatctcaaggagtgctac
ctgatagagaactcccaagaacctgatgctcccattgtgattttcttcccactcatcaat
gacaccttccagaagtacaaggccccaggtgtggagaggagccccgaggagctggagcag
ggccacgttgacatttatggccccaaaactccatatgctaccaaggagctgacatacaca
gaggccgcctttgacaagctggtgaagctctctgagtacaacatcctgaataacaaagac
aagctctttcaggccttgagactggcggtggagaagaagaaacgcctgaagagccagtgt
ccctcctaa

DBGET integrated database retrieval system