KEGG   Acinonyx jubatus (cheetah): 106968756
Entry
106968756         CDS       T04657                                 

Gene name
AFF3
Definition
(RefSeq) AF4/FMR2 family member 3 isoform X1
  KO
K15195  AF4/FMR2 family member 3
Organism
aju  Acinonyx jubatus (cheetah)
Brite
KEGG Orthology (KO) [BR:aju00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:aju03021]
    106968756 (AFF3)
Transcription machinery [BR:aju03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     106968756 (AFF3)
SSDB
Motif
Pfam: AF-4 AF-4_C AF4_int
Other DBs
NCBI-GeneID: 106968756
NCBI-ProteinID: XP_026928462
Position
Unknown
AA seq 1256 aa
MDSFDLALLQEWDLESLWGEDILSQRNDSLVVEFQSSASRCRRYYFGVYEPDRNVLRRKE
RERRNQETQQDDGAFNSSYSLFSEPYKTNKGDELSNRIQNTLGNYDEMKDFLTDRSNQSH
LVGVPKPGVPQAPVNKIDEHFVTDSRAQTQPSSVCSTASSTPAAVPVQQSKRGTMGWQKA
GHPPSDGQQRATQGSLRTLLGDGVGRQQPRAKQVCNVEVGLQTQERPPAMAAKHSSSGHC
VQNFPPSLASKPSLVQQKPTAYVRPMDGQDQAPDESPKLKSSTETSVHCTSYRGVPATKP
ESTRAKAKLSKFSIPKQGEESRSGDTNSCVEEIIREMTWLPPLSAVQAPGKVEPSKFPFP
NKDSQLVSSGHNNPKKGDAEPESPDNGTSNTSMLEDDLKLSSDEEENEQQAAQRTALHAL
SDSAVVQQANCRASVPSSKGSSSGSSSGSSSSSSDSESSSGSDSETESSSSESEGSKPPH
YSSPEAEPASSNKWQLDKWLNKVNPHKPPILIQNESHGPESNQYYTPAKDEVQDCGKLPD
GCQTSLREKDLKSTCKEEQRPRTANKAPGSKGVKQKSPPAAVAVAVTTAAQPPAVPGTPA
ESAPAPARRSAGKKPTRRTERTSAGDGANCHRPEEPAAADALGASVVIPPEPTKTRPCGN
SRTSHRKELRSSVTCEKRRTRGLSRIVPKSKEFIETESSSSSSSSDSDLESEQEEYPLSK
AQAVAAAAAASGSEQRLKEAANSISSGGGPRAPVGSINARTTSDIAKELEEQFYTLVPFG
RNELLSPLKDSDEVRSLWVKIDLTLLSRIPEHLPQEPGVLNAPAAKDAESAQPSHPSDTP
AEKALPKSKRKRKCDNEDDYREVKKAQGEKESSSRLTASANNTLSTNHCSMNINSLAIPI
NKNEKMLRSPISPLSDASKHKYSSEDLTSSSRSNGNGLFTSASSNKKHKAENQLQSHAGD
LTKAAHNNSENVLHKSRPQTEPWSPGSNGHRDCKRQKLIFDDMPRSADYFMQEAKRMKHK
ADAMVEKFGKALNYAEAALSFIECGNAMEQGPMESKSPYTMYSETVELIRYAMRLKTHSG
PNATPEDKQLAALCYRCLALLYWRMFRLKRDHAVKYSKALIDYFKNSSKAAQAPSPWGAS
GKSTGTPSPMSPNPSPTSSVGSQGSLSNANTLSPSTIVSIPQRIHQMAANHVSITNSILH
SYDYWEMADNLAKENREFFNDLDLLMGPVTLHSSMEHLVQYSQQGLHWLRNSTHLS
NT seq 3771 nt   +upstreamnt  +downstreamnt
atggacagcttcgacttagccctgctccaggaatgggacctcgagtcgctgtggggtgaa
gacatcttaagccagaggaatgactctctagttgtggaatttcagtcgtcagccagcaga
tgtaggaggtattattttggtgtctatgaaccagatagaaatgtgttacggaggaaagaa
cgagaaagaagaaatcaggaaactcagcaggatgatggcgcatttaattcgagttactcc
cttttcagtgaaccctacaagacgaacaagggagatgagctctccaaccggatccagaat
actttaggcaattacgatgaaatgaaagactttttaactgatagatctaatcagagtcat
ctcgttggcgttcccaaacctggggttcctcaggctcctgtgaacaagatcgatgaacat
tttgttacagattcaagagcccagacccagccctcatctgtctgtagcactgcatcttcc
acaccagcagctgtccccgtgcagcagagtaagaggggcaccatgggctggcagaaggct
gggcacccaccatcagatggccaacagagagcaacacaaggctctctcaggaccttgctt
ggagatggtgttggcagacagcagccacgagccaagcaagtgtgcaatgtagaggtgggt
cttcagacccaggaaaggccacctgctatggcagccaagcacagcagcagcggacactgt
gttcagaactttcctccatccctggcttcaaaacccagcctggttcagcagaaaccaact
gcatatgtgcggccgatggacggccaagatcaggctcctgatgagtctccaaagcttaag
tcatccacagaaaccagtgtgcactgtacgtcatacaggggagtcccggccaccaagcca
gagtccaccagagccaaggccaagctgtccaagttcagcatccccaagcaaggagaggag
agtagatctggagacacaaacagctgtgttgaagaaataattcgggagatgacctggctc
ccaccactttctgctgttcaagcacctggcaaagtggaaccaagcaaatttccatttcca
aataaggactctcagcttgtttcctctggacacaataatccaaagaaaggtgatgctgag
ccagagagtcctgacaatggcacatcgaatacatcaatgctagaagatgaccttaagcta
agtagtgatgaagaggagaatgaacagcaggcagcccagagaactgctctccacgctctg
tctgacagcgccgtggtccagcaggccaactgcagagcctctgtgccttccagcaagggc
agcagcagcggcagcagcagtggcagcagcagctcctccagtgactcagagagcagctcg
ggatctgactcggagacggagagcagttccagcgagagtgagggcagcaagcctccccac
tactccagccctgaggccgaaccagcgtcctctaacaagtggcagctggataaatggctg
aacaaagttaatccccacaagccgcctatcctgatccaaaatgaaagccacgggccagag
agcaatcaatactacaccccggccaaagacgaagtgcaggactgtgggaaacttcccgac
ggttgccaaaccagcctgagagagaaggacctcaagagcacctgcaaggaggagcagagg
ccaaggacagcgaacaaggccccggggagcaaaggagtgaagcagaagtctccacctgcg
gccgtggccgtggctgtgaccacagctgcccagccgcccgctgtacccggcacacccgcc
gagagcgcacccgcgcctgcgcggaggtctgcgggcaagaagcccaccaggcgcacggag
aggacctctgccggcgacggtgccaactgccaccggcccgaggagccagcagccgccgac
gcgctgggggcaagcgtggtgattcccccggagcccaccaaaaccaggccctgcggcaac
agcagaacgagccaccgcaaggagctgcgctcctccgtgacctgcgagaagcgccgcacg
cgggggctgagccgcatcgtccccaaatccaaggagttcatagagacagagtcgtcatct
tcgtcctcctcctcggactcagacctggaatcggagcaggaggaataccctctgtccaaa
gcgcaggccgtggccgccgcagccgccgcctcggggagtgagcagagactaaaggaggct
gccaacagcatcagcagcggtgggggcccccgggcccccgtaggctccatcaacgccagg
accaccagtgacattgccaaggagctggaggagcagttctacacactggtccctttcggc
cggaatgaacttctctcccccttgaaggacagtgatgaggtcaggtctctctgggtcaaa
attgacctgaccctcctatccaggatcccagaacacctgccccaggagccgggggtcttg
aatgctcctgcagccaaggacgctgagagtgcacagcccagccatccatctgacactcct
gccgaaaaggctttgccaaaatccaagaggaaacgcaagtgtgacaacgaagatgactac
agggaggtcaagaaggcccagggagagaaagagagctcttcacgactgactgcctctgcc
aataatactttatccacgaaccactgcagcatgaacatcaacagcttggcaataccaata
aataaaaatgaaaaaatgctccggtcacccatctcgcccctgtctgatgcatctaaacac
aaatactccagcgaggacttaacttcttccagcagatcaaatggcaacggtttgttcact
tccgcctcctccaacaaaaagcataaggctgagaaccagctgcagtctcatgccggagac
ctcacaaaagccgctcacaacaattccgaaaacgttctccacaagtcacggccacaaaca
gagccatggtctccaggttccaacggccacagggactgcaagaggcagaaacttatcttc
gatgatatgccacgcagtgcagattattttatgcaggaagctaaacggatgaagcataaa
gcagatgcaatggtggaaaagtttggaaaggctttgaattatgctgaagcagctttgtca
tttattgagtgtggaaatgcaatggaacaaggcccaatggaatccaaatctccctataca
atgtattcggaaacagtagagctcatcaggtatgctatgagactaaaaacccattcaggc
cctaatgccacaccagaagacaaacaactggctgcattatgttatcgatgcctggctctc
ctgtactggcggatgtttcgactcaagagggaccacgctgtgaagtactcaaaagcactt
atcgactatttcaagaattcatctaaagctgcccaagccccatctccatggggagccagt
ggaaagagcactggaaccccatcccccatgtctcccaacccctctccgaccagctccgtg
ggatctcaggggagcctctccaatgccaacaccctgtccccttccaccatcgtcagcatc
ccacagcgcatccaccagatggcagccaaccacgtcagcatcaccaacagcattctccac
agctatgactactgggagatggcggacaacctagccaaggaaaacagagaattcttcaac
gacctggatttgctcatggggcctgtcaccctgcacagcagcatggagcacctggtccaa
tactcccagcagggcctgcactggctacggaacagcacccacctgtcatag

DBGET integrated database retrieval system