KEGG   Acinonyx jubatus (cheetah): 106969236
Entry
106969236         CDS       T04657                                 

Gene name
ASIC1
Definition
(RefSeq) acid-sensing ion channel 1 isoform X1
  KO
K04829  acid-sensing ion channel 1
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:aju00001]
 09150 Organismal Systems
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    106969236 (ASIC1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:aju04040]
    106969236 (ASIC1)
Ion channels [BR:aju04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   106969236 (ASIC1)
SSDB
Motif
Pfam: ASC
Other DBs
NCBI-GeneID: 106969236
NCBI-ProteinID: XP_026891897
Position
Unknown
AA seq 559 aa
MPIQIFCSVSFSSGEEAPGPLGDVWGPHQRRQRDKSESEEEEEKEKEAVRKKAREGDSPM
DLVAFANSCTLHGTSHIFVEGGPGPRQALWAVAFVLALGAFLCQVGDRIAYYLSYPHVTL
LDEVATTELAFPAVTLCNTNAVRLSQLSYPDLLYLAPMLGLDESDDPGVPLAPPGPEAFS
GEPFNLHRFYNRSCHRLEDMLLYCSYCGGPCGPHNFSVVFTRYGKCYTFNSGRDGRPRLK
TMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPFIDQLGFGVAPG
FQTFVSCQEQRQLIYLPPPWGTCKAVTMDSDFFDSYSITACRIDCETRYLVENCNCRMVH
MPGDAPYCTPEQYKECADPALDFLVEKDQEYCVCEMPCNLTRYGKELSMVKIPSKASAKY
LAKKFNKSEQYIGENILVLDIFFEVLNYETIEQKKAYEIAGLLGDIGGQMGLFIGASILT
VLELFDYAYEVIKHKLCRRGKCQKEAKRSSADKGVALSLDDVKRHNPCESLRGHPAGMTY
AANILPHHPARGTFEDFTC
NT seq 1680 nt   +upstreamnt  +downstreamnt
atgcccatccagatcttctgctctgtgtcattctcctctggagaggaagccccagggccc
ttgggagatgtttggggtccgcaccagcggcggcagcgggacaagtcagaatcagaagag
gaggaagagaaggaaaaggaggcagtgaggaagaaggctagagagggggattcgcccatg
gatttggtggcctttgccaacagctgcaccctgcatggcaccagccacatcttcgtggag
gggggtccagggccgaggcaggccctgtgggcagtggcctttgttctggcactgggtgcc
ttcttgtgccaggtaggggaccgcattgcctattacctcagctacccgcacgtgactctg
ctagacgaggtggccaccacagagctggccttcccggcggtcaccctctgcaacactaat
gctgtgcggctgtcccagctcagctaccccgacttgctctacctggcccccatgctgggg
ctggatgaaagtgatgaccctggggtgcctctggccccaccggggcctgaggccttctct
ggggagccctttaacctgcaccgcttctacaatcgctcttgccaccggctggaggacatg
ctgctctattgttcctactgcggggggccctgtggccctcacaacttctcggtggtcttc
acacggtatggaaagtgctacacattcaactcgggccgagatgggcgtccacggctgaag
accatgaagggtgggactggcaatgggctggagatcatgctggacatccagcaggacgag
tacctgcccgtatggggagagactgatgagacgtccttcgaagcgggcatcaaagtgcag
atccacagtcaggatgaacctcccttcatcgaccagctgggctttggtgtggccccaggg
ttccagacctttgtgtcctgccaggagcagcggcagctcatctacctgcccccgccctgg
ggcacctgcaaagctgttaccatggactcggatttcttcgactcctacagcataactgcc
tgccgcatcgactgtgagacacgctacctggtggagaactgtaactgtcgcatggtgcac
atgccaggggatgccccatactgcactccagaacagtacaaggagtgtgcggatcctgct
ctggacttcctggtggagaaggaccaggaatactgtgtgtgtgaaatgccctgcaaccta
acccgctatggcaaggagctgtccatggtcaagatccccagcaaagcgtcagccaagtac
ctggccaagaagttcaacaagtctgagcagtacataggggagaacatcctggtgctggac
attttctttgaagtcctcaactatgagactattgagcagaagaaggcctatgaaattgca
gggctcctgggtgacattggaggccagatgggcctgttcattggggccagcatcctcaca
gtactggagctctttgactacgcctatgaggtcattaagcacaagctgtgcagaagagga
aagtgccagaaggaggccaaaaggagcagcgcggacaagggtgtggcccttagcctggat
gacgtcaaaagacataacccgtgtgagagcctccggggccatcctgccgggatgacgtat
gctgccaacatcctacctcaccatccggcccgaggcacttttgaggactttacctgctga

DBGET integrated database retrieval system