KEGG   Acinonyx jubatus (cheetah): 106969394Help
Entry
106969394         CDS       T04657                                 

Gene name
EIF3A
Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit A
  KO
K03254  translation initiation factor 3 subunit A
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju03013  RNA transport
Brite
KEGG Orthology (KO) [BR:aju00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    106969394 (EIF3A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:aju03012]
    106969394 (EIF3A)
Translation factors [BR:aju03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    106969394 (EIF3A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCI
Motif
Other DBs
NCBI-GeneID: 106969394
NCBI-ProteinID: XP_026919026
Position
Unknown
AA seq 1344 aa AA seqDB search
MPAYFQRPENALKRANEFLEVGKKQPALDVLYDVMKSKKHRTWQKIHEPIMLKYLELCVD
LRKSHLAKEGLYQYKNICQQVNIKSLEDVVRAYLKLAEEKTEAAKEESQQMVLDIEDLDN
IQTPESVLLSAVSGEDTQDRTDRLLLTPWVKFLWESYRQCLDLLRNNSRVERLYHDIAQQ
AFKFCLQYTRKAEFRKLCDNLRMHLSQIQRHHNQSTAINLNNPESQSMHLETRLVQLDSA
ISMELWQEAFKAVEDIHGLFTLSKKPPKPQLMANYYNKVSTVFWKSGNALFHASTLHRLY
HLSREMRKNLTQEEMQRMSTRVLLATLSIPITPERTDIARLLDMDGIIVEKQRRLATLLG
LQAPPTRIGLINDMVRFNVLQYVVPEVKDLYNWLEVEFNPLKLCERVTKVLNWVREQPEK
EPELQQYVPQLQNNTILRLLQQVAQIYQSIEFSRLTSLVPFVDAFQLERAIVDAARHCDL
QVRIDHTSRTLSFGSDLNYATREDAPIGPHLQSMPSEQIRNQLTAMSSVLAKALEVIKPA
HILQEKEEQHQLAVTAYLKNSRKEHQRILARRQTIEERKERLESLNIQREKEELEQREAE
LQKVRKAEEERLRQEAKEREKERILQEHEQIKKKTVRERLEQIKKTELGAKAFKDIDIED
LEELDPDFIMAKQVEQLEKEKKELQERLKNQEKKIDYFERAKRLEEIPLIKSAYEEQRIK
DMDLWEQQEEERITTMQLEREKALEHKNRMSRMLEDRDLFVMRLKAARQSVYEEKLKQFE
ERLAEERHNRLEERKRQRKEERRITYHREKEEEEQRRAEEQMLKEREERERAERAKREEE
LREYQERVKKLEEVERKKRQRELEIEERERRREEERRLGDDPLSRKDSRWGDRDSEGTWR
KGPEVDSEWRRGPPEKEWRRGEGRDEERPHRREDDRPRRLGDEEERESSLRADDDRIPRR
GMDEDRGPRRGLDEDRFSRRGADDDRPSWRSADDDRPPRRIGDEDRGSWRHVDDDRPPRR
GLDEDRGSWRTADEDRGPRRGMDEDRGPRRGGADDERSSWRNADDDRGPRRGMDDDRGPR
RGLDDDRGPWRNADDDRISRRGADDDRGPWRSTDDDRIPRRGEDSRPGPWRPFVKPGGWR
EKEKAREESWGPPRESRPSEEREWDREKERERDNQDRDENDKDPEKERERERDREREGDR
EDRFRRPRDEGGWRRGPAEESSSWRDSARRDDRDRDDRRRERDDRRDLRERRDDRDRRGP
PLRSEREEVSSWRRADDRKDERAEEREAPRRVPPPALSRDRERDREREREGEKEKSSWRA
EKDRESLRRTKNETDEDGWTTVRR
NT seq 4035 nt NT seq  +upstreamnt  +downstreamnt
atgccggcctatttccagaggccggaaaatgccctcaaacgcgccaacgaatttcttgag
gttggaaaaaagcagcctgctttggatgttctttatgatgttatgaaaagtaagaaacac
agaacatggcaaaagatacacgagccaattatgttgaaatacttggaactttgtgtggat
cttcgcaagagccatttggctaaagagggattataccagtataagaacatttgtcaacag
gtgaacatcaaatctctagaggatgttgttagggcatatttgaaattggcagaggaaaaa
actgaagctgctaaagaagaatctcagcaaatggtcctagacatagaagatctggataat
attcaaactcctgagagtgttctcctaagtgctgtaagtggtgaagacactcaggatcgt
actgacagactacttttaactccatgggttaaattcctttgggaatcatatagacagtgt
ttggaccttcttcgaaataattctagagtagagcgtctctaccatgatattgcccaacaa
gctttcaaattctgcctccaatacacacgtaaggctgaattccgtaagctttgtgacaat
ttgagaatgcacttgtcacagattcaacgccaccataaccaaagtacagcaatcaatctt
aataatccagaaagccagtccatgcatttggagaccaggcttgttcaattggacagtgct
atcagcatggaattgtggcaggaagcgttcaaagctgtggaagatattcatggactattt
accttgtctaaaaaaccacctaaacctcagttgatggcaaattactataacaaagtctcg
actgtgttttggaaatctggaaatgctctttttcatgcatctacactccatcgtctttac
catctatccagagaaatgagaaagaatcttacacaggaagagatgcaaagaatgtctact
agagtccttttggccactctttccatccctattacccctgagcgtactgatattgctcga
cttctggatatggatggcattatagtcgaaaaacaacgtcgccttgcaacgctgctaggt
cttcaagccccaccaacacgaattggccttattaacgatatggtcagattcaatgtattg
cagtatgttgttcccgaagtgaaagacctttacaattggctggaagtagaatttaacccg
ctaaaactctgcgagagagtcacaaaggttctaaattgggttagggaacaacctgaaaag
gaaccagagttgcaacagtatgtcccacagctgcaaaacaacaccatacttcgtcttctg
cagcaggtggcacagatttatcagagcattgagttttctcgtttgacttctctggttcct
tttgttgatgctttccaactggaacgggctatagtagatgctgccaggcactgtgatctg
caggttcgtattgaccacacttctcggacccttagttttggatctgatttgaattacgct
actcgagaagatgctccaattggtcctcatttgcaaagcatgccttcagaacagatcaga
aatcagttgacagcgatgtcttcagtacttgcaaaggcacttgaagtcattaagccagct
catattttgcaagagaaagaagaacagcatcagttggctgttactgcataccttaaaaac
tcccgaaaagagcatcagcgtatcctggctcgccgtcagacaattgaggaaaggaaagag
cgccttgagagtctcaatattcagcgtgagaaggaagaattggagcagagggaagctgaa
cttcagaaagtaaggaaagctgaagaagagaggttgcgacaggaggcaaaggagagagag
aaggagcgcatcttacaggaacatgaacaaatcaaaaagaaaactgtccgtgagcgtttg
gagcagatcaagaaaacggaactgggtgccaaagcgttcaaagacattgatattgaagat
ctggaagaattggatccagattttatcatggctaaacaggttgaacaactggagaaagaa
aagaaggaacttcaggaacgcctgaagaatcaagaaaagaagattgattattttgaacga
gctaaacgcttggaggaaatccctttgataaagagcgcatatgaagaacagaggattaaa
gacatggatctgtgggaacagcaagaagaagaaagaattactaccatgcaactagaacgt
gaaaaggctctcgaacataagaatcgaatgtcacgaatgcttgaagacagagatttattt
gtaatgcgactcaaggccgcacgacagtctgtttatgaggaaaaacttaaacaatttgag
gagagattagcagaagaaaggcataatcggttggaagagcgcaaaaggcagcgtaaagaa
gaacgcagaataacctaccatagagaaaaagaagaggaggagcagaggagggcagaagaa
cagatgttgaaagagcgtgaagagagagagcgtgctgaacgggcaaaacgtgaagaagag
ctacgagaatatcaggagcgggtcaagaaattagaagaagtggaaaggaaaaaacgccaa
agagagctggaaattgaagaaagggaacgacgtagagaggaagagagaagacttggtgac
gatccactttctagaaaggactctcgttggggagatagagattcagaaggcacatggaga
aaaggacctgaagtagattccgagtggagaagaggcccaccagagaaggagtggagacgt
ggagaggggcgggatgaggagaggcctcatagaagagaggatgatcggccaaggcgactg
ggggatgaggaagagagagagtcttctctccgagcagatgatgatcgcattccccggcgt
ggcatggatgaggacagaggtcccagacgtggccttgatgaagaccggttctctcgccgg
ggggcagatgatgaccggccttcctggcgtagtgcagatgatgacaggcctcccaggcga
attggggatgaagacaggggaagctggcgtcatgtggatgatgacagaccacctagacgg
ggactggatgaggacagaggaagctggcgaacagctgatgaggacagaggaccaagacgt
gggatggatgaggaccgggggccacggcgaggaggtgcagatgacgagcggtcttcctgg
cgtaatgctgatgacgatcggggtcccaggcgcggcatggatgatgaccggggcccaagg
cgtgggttggatgatgatcgaggaccttggaggaatgctgatgatgacagaatttccaga
cgtggtgcagatgatgaccgggggccttggagaagcacagatgatgatcggattcccaga
aggggcgaggactcaaggcctggtccctggagaccatttgtcaagccaggtggatggaga
gagaaagaaaaggccagagaagagagttggggtccacctcgagaatcgagaccatcagaa
gaacgtgaatgggatagagaaaaagaaagagagcgagataaccaagatcgtgatgaaaat
gacaaggacccagagaaagaaagagagcgagaaagggacagagagcgagagggggatcga
gaagaccgcttcagacggccgagggatgaaggtggctggagaagaggaccagcggaggaa
tcttcgagctggagagattcagctcgccgagatgatagggatcgggatgaccgtcgtcgg
gagagagatgatcgccgtgacctaagagaaaggcgagatgacagagaccgaagaggacct
cctctcagatcagaacgtgaagaagtaagttcttggagacgtgctgatgacaggaaagat
gagcgggcagaagagcgggaagcccctcgtcgtgttcctcccccagctctttcaagagac
cgggaaagagaccgagaaagggagagagaaggtgaaaaagagaagtcctcttggagagct
gagaaagatcgggagtctcttcgtcgtaccaaaaatgagactgatgaagatgggtggacc
acggtacgacgttaa

DBGET integrated database retrieval system