KEGG   Acinonyx jubatus (cheetah): 106970393Help
Entry
106970393         CDS       T04657                                 

Gene name
PARP12
Definition
(RefSeq) poly [ADP-ribose] polymerase 12
  KO
K15259  poly [ADP-ribose] polymerase 7/11/12/13 [EC:2.4.2.30]
Organism
aju  Acinonyx jubatus (cheetah)
Brite
KEGG Orthology (KO) [BR:aju00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    106970393 (PARP12)
Enzymes [BR:aju01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     106970393 (PARP12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP WWE HTH_53 zf-CCCH Torus zf-CCCH_8 zf-CCCH_4
Motif
Other DBs
NCBI-GeneID: 106970393
NCBI-ProteinID: XP_026931392
Position
Unknown
AA seq 702 aa AA seqDB search
MAQAGVLGEVTQVLCAAGGALELEELRRRLREGVGNDALERLLRDRGRFAVAARAGGAAA
SAQRVVVAVSALRLCRAYQSPKPGCVGLCAQLHLCKFLVYGACKFMRAGKNCRNSHSLTT
DHNLSVLRTHGVDHLSYSELCQLLFQNDPWLLPEICLHYNKGDGPYGSCSFQKQCIKLHI
CQYFLQGECKFGTGCKRSHDISNSENLEKLEKLGMNSDLVNRLPSIYRNAHDIKNRSSTS
SRGHPPPPGPQATSERRDSSGCGSPNNANQEENDQICLYHIRKSCSFQDKCNKVHFHLPY
RWQFLDRGKWKDLDKMELIEEAYSNPRKDRILCAESASNFHFDCLDFDSMMFGAAPARRL
STASSVTKPPHFILTTDWVWYWTDEFGSWQEYGRQGMEHPVTTVCSSDLEKAYLAYCAPG
SDAQAAILKFQAGKHKYELDFKAFVQKNLVYGTVRRVCRRPKYVSPQEVKVKQTCSVKFQ
GPKSIPDHWDPSALPDPGFKKIALSSASDEYQKVWNLFNRTLPFYFVQKIERVQNLALWE
VYQWQKGQMQKRNGGKVVDERQLFHGTSASFVDAICQQNFDWRVCGLHGTSYGKGSYFAR
DAAYSHHYSKSDTKSHTMFLARVLVGEFVRGSASFVRPPAKEGHGNVFYDSCVNSMSDPS
IFVIFEKHQIYPEYIIQYTSSTKPVAGVSTLFSLASFFGGRQ
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaggctggcgtcctcggcgaggtgacccaggtgctgtgcgcggccgggggcgcc
ttggagctggaggagctgcggcgccgcttgcgggagggcgtcggcaacgacgcgctggag
cggctgctgcgggaccgcggccgcttcgcggtggcagcgagggcgggcggcgcggcggcc
tccgcgcagcgcgtcgtggtggccgtctcggcgctgcgcctgtgccgcgcgtaccagagc
cccaagccgggctgcgtggggctgtgcgctcagctgcacctctgcaagttcttggtctac
ggggcctgcaagttcatgagggccgggaagaactgtagaaacagtcacagcttgacgaca
gatcacaacctgagtgtgctgagaactcacggtgttgaccacctcagctacagtgagctc
tgccagcttttgtttcagaatgacccctggcttttgccagagatctgcctacattacaac
aaaggagatggaccctacggctcttgttcctttcaaaagcagtgtatcaaactccatatc
tgccagtattttttacagggtgaatgcaagtttggcactggctgtaagagatctcatgat
atctctaattctgagaatctggagaaactggagaagttgggcatgaactccgatctggtg
aacaggctgccttccatatacagaaatgctcacgacatcaagaataggagctccacctcc
agcagagggcaccctcctcctccaggcccacaggccacttctgaaagaagagatagttca
ggttgtggatccccaaacaatgctaaccaggaggagaatgatcagatctgcttgtaccac
atccggaaaagttgtagctttcaagataagtgcaataaagttcatttccatttgccatat
cgatggcagttcttggacagaggcaaatggaaggatttggacaaaatggagcttattgaa
gaggcatatagcaatcccagaaaagacaggatcctctgtgctgagtcagccagcaacttt
cactttgattgtctagactttgactccatgatgtttggtgctgccccagcccgccgcctc
tccacagcctcctcggttactaaacctccacacttcatcctcaccactgactgggtttgg
tactggactgatgagtttggttcttggcaggagtatggaagacaaggcatggagcacccc
gtgaccaccgtctgcagcagcgatttggagaaggcctacctggcatactgtgcacctggg
tctgatgcccaggcagccattctgaagttccaggctggaaagcacaaatatgagttagat
ttcaaagcctttgttcagaaaaacctggtctatggcacggtcagaagggtttgccggaga
cccaaatacgtgtctccccaggaggtgaaggtgaagcaaacctgcagtgtcaagtttcaa
ggcccaaagagcatcccagaccattgggacccctcggccctgccagaccctggcttcaag
aagattgccctcagttctgcatcggatgaatatcagaaggtctggaacctctttaaccgc
acactgcctttctactttgttcagaagatcgagcgagtccaaaatctggccctctgggaa
gtctaccagtggcaaaaagggcagatgcagaagagaaatggagggaaggtggtagatgag
aggcagctgttccatggcaccagtgccagtttcgttgatgccatctgccagcagaacttt
gactggagggtctgtggtcttcatggtacttcttacggcaaagggagctactttgcccgc
gacgccgcatattcccaccactacagcaaatctgacaccaagtcccacacgatgttcctg
gcccgggtgctggtcggggagttcgtccgaggcagcgcctccttcgtccgccccccggcc
aaggaaggccacggcaacgtcttctatgacagctgcgtgaacagcatgtccgacccctcc
atcttcgtgatcttcgagaagcaccagatctaccctgagtacatcatccagtacaccagc
tccaccaagcccgtggcgggggtctccaccctcttctccttagcatctttctttggcggc
cggcagtga

DBGET integrated database retrieval system