KEGG   Acinonyx jubatus (cheetah): 106971150
Entry
106971150         CDS       T04657                                 

Gene name
TM7SF2
Definition
(RefSeq) delta(14)-sterol reductase isoform X1
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju00100  Steroid biosynthesis
aju01100  Metabolic pathways
Module
aju_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:aju00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    106971150 (TM7SF2)
Enzymes [BR:aju01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     106971150 (TM7SF2)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT PEMT
Other DBs
NCBI-GeneID: 106971150
NCBI-ProteinID: XP_026901262
UniProt: A0A6J1Y8D2
Position
Unknown
AA seq 425 aa
MGRGRVHLKTSALGRLWSELGDQAGAAALMVLLPATMFHLLLVARSGPARLLGPPPYLPG
PDVLWSPRVLLLWLTWLGLQAALYLLPARKVAEGLELKDKSRLRYPINGFQALVLTALLV
GLAVSAGLPLGALPEMLVPLAFAATLTAFIFSFLLYLKALGVPPSALAPGGTSGNPIYDF
FLGRELNPRICSFDFKYFCELRPGLIGWVLINLALLMQEAELRGSPSLAMWLVNGFQLFY
VGDALWHEEAVLTTMDITHDGFGFMLAFGDLAWVPFTYSLQAQFLLHHPQPLGLPMASAI
CLINALGYYIFRRANSQKNTFRKNPSDPRVAGLETIPTATGRQLLVSGWWGLVRHPNYLG
DLIMALAWSLPCGVSHLLPYFYFLYFTALLVHREARDEQQCLQKYGLAWQEYCRRVPYRI
VPYVY
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgggccgggggcgggtccatttaaagacctcggcactcgggcgcttgtggtccgagctc
ggggaccaagcaggcgccgcggcgctgatggtgctgctccccgccaccatgttccacctg
ctcctggtggcccgctcgggcccggcgcgcctgctgggcccacccccctacctgccgggt
cccgacgtgctgtggagcccgcgggtgctgctgctgtggctcacctggctcggccttcag
gcggctctctacctactgccggcgcgcaaggtggccgaggggctggaattgaaggacaag
agtcgcctgcgctaccccattaacggcttccaggccctggtgctgacggccctgttggtg
ggcttggcagtgtccgcggggctgcctctgggggcgctcccggaaatgctcgtgcccttg
gcgtttgcggccaccctcaccgccttcatcttcagcttccttctctacctgaaggctctg
ggagtccctccctccgccctggcacctggggggacctcaggcaaccccatctacgacttt
ttcctgggacgggagctcaacccgcgcatctgttcctttgacttcaaatatttctgtgaa
ctgcggcctggcctcatcggctgggtcctcatcaacctggccctgctgatgcaggaagcg
gaacttcgggggagtccctcactggccatgtggctggtcaacggcttccagctattctat
gtgggtgatgctctctggcatgaggaggctgttctcaccaccatggacatcacacacgac
gggtttggcttcatgctggcctttggggacctagcctgggtacccttcacttacagcctg
caggcccaatttttgctgcatcacccgcagcccctggggttgcccatggcctccgccatc
tgtctcatcaacgctcttggttactacatcttccgaagagccaattcccagaagaacacc
ttccgaaagaatccttctgaccccagagtggctggccttgagaccatccccacggccacg
gggcggcagctgctggtgtctgggtggtggggtctggtccgccaccccaactacctcggg
gacctcatcatggctctggcgtggtccttgccctgcggggtgtctcacctgctgccctac
ttctacttcctctacttcacggcgctcctggtgcaccgggaggcccgggatgaacagcag
tgcctacagaagtacggcctggcctggcaggagtactgccggcgcgtgccttaccgaatc
gtgccctacgtctactga

DBGET integrated database retrieval system