KEGG   Acinonyx jubatus (cheetah): 106971526Help
Entry
106971526         CDS       T04657                                 

Gene name
ACVR2A
Definition
(RefSeq) activin receptor type-2A isoform X2
  KO
K13596  activin receptor type-2B [EC:2.7.11.30]
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04060  Cytokine-cytokine receptor interaction
aju04350  TGF-beta signaling pathway
aju04550  Signaling pathways regulating pluripotency of stem cells
aju05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    106971526 (ACVR2A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    106971526 (ACVR2A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    106971526 (ACVR2A)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    106971526 (ACVR2A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aju01001]
    106971526 (ACVR2A)
Enzymes [BR:aju01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     106971526 (ACVR2A)
Protein kinases [BR:aju01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   106971526 (ACVR2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Activin_recp Pkinase_fungal FTA2 APH
Motif
Other DBs
NCBI-GeneID: 106971526
NCBI-ProteinID: XP_014923853
Position
Unknown
AA seq 513 aa AA seqDB search
MGAAAKLAFAVFLISCSSGAILGRSETQECIFYNANWERDRTNRTGVEPCYGDKDKRRHC
FATWKNISGSIEIVKQGCWLDDINCYDRTDCIEKKDSPEVYFCCCEGNMCNERFSYFPEM
EVTQPTSNPVTPKPPYYNILLYSLVPLMLIAGIVICAFWVYRHHKMAYPPVLVPTQDPGP
PPPSPLLGLKPLQLLEVKARGRFGCVWKAQLLNEYVAVKIFPIQDKQSWQNEYEVYSLPG
MKHENILQFIGAEKRGTSVDVDLWLITAFHEKGSLSDFLKANVVSWNELCHIAETMARGL
AYLHEDIPGLKDGHKPAISHRDIKSKNVLLKNNLTACIADFGLALKFEAGKSAGDTHGQV
GTRRYMAPEVLEGAINFQRDAFLRIDMYAMGLVLWELASRCTAADGPVDEYMLPFEEEIG
QHPSLEDMQEVVVHKKKRPVLRDYWQKHAGMAMLCETIEECWDHDAEARLSAGCVGERIT
QMQRLTNIITTEDIVTVVTMVTNVDFPPKESSL
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgggagctgctgcaaagttggcgtttgccgtctttcttatctcttgttcttcaggtgct
atacttggtagatcagaaactcaggagtgtattttctataatgctaattgggaaagagat
agaaccaatcgaactggtgttgaaccctgttatggtgacaaagataaaaggcgacattgt
tttgctacctggaagaatatttctggttccattgaaatagtgaagcaaggttgttggctg
gatgatatcaactgttatgacaggactgattgtatagaaaaaaaggacagccctgaagta
tatttttgttgctgtgagggcaatatgtgtaacgaaaggttttcctactttccagagatg
gaagttacacagcctacttcgaacccagttacacctaagccaccctattacaacatattg
ctctattccttggtgccacttatgttaattgcggggattgttatttgtgcgttttgggtg
tacaggcatcataagatggcctaccctcctgtacttgttccaactcaagacccaggacca
cccccaccttctccgttactaggtttgaagccactacagttattagaagtgaaagcaagg
ggaagatttggttgtgtttggaaagcccagttgctcaatgaatatgtagctgtgaaaata
tttccaatacaggacaaacagtcatggcaaaatgaatatgaagtttatagtttacctgga
atgaaacatgagaacatattacagttcattggtgcagaaaaacgaggcaccagtgttgat
gtggacctttggctaatcacagcatttcatgaaaagggttcactgtcagactttctaaag
gctaatgtggtctcttggaacgaattgtgtcatattgcagaaaccatggcaagaggattg
gcatacttacatgaggatatacctggcctaaaagatggccacaaacctgccatatctcac
agggacatcaaaagtaaaaatgtgctgttgaaaaacaacctgacagcttgcattgcagac
tttgggttggcgttaaaatttgaggctggcaagtctgctggtgatacccatggacaggtt
ggtacccggaggtatatggctccagaggtattagagggtgctataaacttccaaagggat
gcatttttgaggatagatatgtacgccatgggattagtcctgtgggaactggcttctcgc
tgtactgctgcagatggacctgtagatgaatacatgttgccatttgaggaggaaattggc
cagcatccatctcttgaagatatgcaggaagttgttgtgcataaaaaaaagaggcctgtt
ttaagagattattggcagaaacatgctggaatggcaatgctctgtgaaacgatagaagaa
tgttgggatcacgatgcagaagccaggttatcagctggatgtgtaggtgaaagaattact
cagatgcaaagacttacaaatatcattactacagaggacattgtaacagtggtcacgatg
gtgacaaatgttgactttcctcccaaagaatctagtctatga

DBGET integrated database retrieval system