KEGG   Acinonyx jubatus (cheetah): 106971689Help
Entry
106971689         CDS       T04657                                 

Gene name
GATC
Definition
(RefSeq) glutamyl-tRNA(Gln) amidotransferase subunit C, mitochondrial
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju00970  Aminoacyl-tRNA biosynthesis
aju01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aju00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    106971689 (GATC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:aju03029]
    106971689 (GATC)
Enzymes [BR:aju01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     106971689 (GATC)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     106971689 (GATC)
Mitochondrial biogenesis [BR:aju03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    106971689 (GATC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glu-tRNAGln
Motif
Other DBs
NCBI-GeneID: 106971689
NCBI-ProteinID: XP_014924042
Position
Unknown
AA seq 136 aa AA seqDB search
MWARAVLLGHRSWMGWHRGFTSKTDPQGSGRVTAEVIEHLERLALVDFGSQEAVARLEKA
IAFADRLRAVDTDGVEPMESVLEDRCLYLRSDNVVEGNCVEELLQNAHRVVEEYFVAPPG
NISLPKQDEQQPFSHN
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgtgggcgcgtgcggtgttgctgggccatcggtcctggatgggctggcaccggggcttc
acctccaagacggatcctcagggtagtggccgtgtcacggctgaggtgatcgagcacctg
gagcgtctagcgcttgtggacttcggcagccaagaggccgtggcacgactggagaaagcc
atcgcctttgccgacaggctccgcgccgtggacacggacggggtggagcccatggaatca
gtattggaggacagatgtctgtacttgagatctgacaatgtggtagaaggcaactgtgtt
gaagaactactacaaaatgcccatcgagttgtggaggagtattttgtggctcccccaggt
aatatctctttgccaaagcaggatgaacaacagcccttttcacacaactga

DBGET integrated database retrieval system