KEGG   Acinonyx jubatus (cheetah): 106972043Help
Entry
106972043         CDS       T04657                                 

Gene name
TGFBR1
Definition
(RefSeq) TGF-beta receptor type-1 isoform X1
  KO
K04674  TGF-beta receptor type-1 [EC:2.7.11.30]
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04010  MAPK signaling pathway
aju04060  Cytokine-cytokine receptor interaction
aju04068  FoxO signaling pathway
aju04144  Endocytosis
aju04218  Cellular senescence
aju04350  TGF-beta signaling pathway
aju04371  Apelin signaling pathway
aju04380  Osteoclast differentiation
aju04390  Hippo signaling pathway
aju04520  Adherens junction
aju04659  Th17 cell differentiation
aju04926  Relaxin signaling pathway
aju04933  AGE-RAGE signaling pathway in diabetic complications
aju05142  Chagas disease (American trypanosomiasis)
aju05161  Hepatitis B
aju05166  Human T-cell leukemia virus 1 infection
aju05200  Pathways in cancer
aju05210  Colorectal cancer
aju05212  Pancreatic cancer
aju05220  Chronic myeloid leukemia
aju05225  Hepatocellular carcinoma
aju05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106972043 (TGFBR1)
   04350 TGF-beta signaling pathway
    106972043 (TGFBR1)
   04390 Hippo signaling pathway
    106972043 (TGFBR1)
   04371 Apelin signaling pathway
    106972043 (TGFBR1)
   04068 FoxO signaling pathway
    106972043 (TGFBR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    106972043 (TGFBR1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    106972043 (TGFBR1)
  09143 Cell growth and death
   04218 Cellular senescence
    106972043 (TGFBR1)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    106972043 (TGFBR1)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    106972043 (TGFBR1)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    106972043 (TGFBR1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    106972043 (TGFBR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106972043 (TGFBR1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    106972043 (TGFBR1)
   05212 Pancreatic cancer
    106972043 (TGFBR1)
   05225 Hepatocellular carcinoma
    106972043 (TGFBR1)
   05226 Gastric cancer
    106972043 (TGFBR1)
   05220 Chronic myeloid leukemia
    106972043 (TGFBR1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    106972043 (TGFBR1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    106972043 (TGFBR1)
   05161 Hepatitis B
    106972043 (TGFBR1)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    106972043 (TGFBR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aju01001]
    106972043 (TGFBR1)
Enzymes [BR:aju01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     106972043 (TGFBR1)
Protein kinases [BR:aju01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   106972043 (TGFBR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr TGF_beta_GS Activin_recp Pkinase_fungal APH Haspin_kinase FTA2
Motif
Other DBs
NCBI-GeneID: 106972043
NCBI-ProteinID: XP_026895335
Position
Unknown
AA seq 509 aa AA seqDB search
MQISEVRVWENVHHRMEEAVAAGRYWGLEATGDQALQCFCHLCTKDNFTCVTDGLCFVSV
TETTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTVGPFS
GKPSSGLGPVELAAVIAGPVCFVCISLMLMVYICHNRTVIHHRVPNEEDPSLDRPFISEG
TTLKDLIYDMTTSGSGSGLPLLVQRTIARTIVLQESIGKGRFGEVWRGKWRGEEVAVKIF
SSREERSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNR
YTVTVEGMIKLALSTASGLAHLHMEIVGTQGKPAIAHRDLKSKNILVKKNGTCCIADLGL
AVRHDSATDTIDIAPNHRVGTKRYMAPEVLDDSINMKHFESFKRADIYAMGLVFWEIARR
CSIGGIHEDYQLPYYDLVPSDPSVEEMRKVVCEQKLRPNIPNRWQSCEALRVMAKIMREC
WYANGAARLTALRIKKTLSQLSQQEGIKM
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgcagatttcagaagtgagagtgtgggaaaatgttcatcatagaatggaggaagctgta
gctgctggtagatattggggcctggaagcaacaggtgaccaagcattacagtgtttctgc
cacctttgtacaaaagacaattttacttgtgtgacagatgggctctgctttgtctctgtc
acagagaccacagacaaagttatacacaatagcatgtgtatagctgaaattgacctaatt
ccccgagacaggccgtttgtgtgtgcaccgtcttcaaaaaccggctctgtcactacaacg
tattgctgcaatcaggaccactgcaataaaatagaactcccgactgttggccctttttca
ggaaagccatcatctggccttggtcccgtcgaattggcagctgtcattgctggaccagtc
tgcttcgtctgcatctcactcatgttaatggtttatatctgccataatcgtactgtcatt
caccatcgagtgccaaacgaagaggatccttccttagatcgtccttttatttcagagggc
actacgttgaaagatttaatttatgatatgacaacatcaggttctggatcaggtttacca
ttgctcgttcagagaacaattgcaagaactattgtgttacaagaaagtattggcaaaggt
cgatttggagaagtttggcggggaaaatggcgaggagaagaagttgctgtcaaaatattc
tcctctagagaagaacgctcgtggttccgtgaggccgagatttatcagaccgtaatgtta
cgccatgaaaacatcttgggatttatagcggcagacaataaagacaacggtacatggact
cagctctggttggtgtcagattatcatgagcatggatccctttttgattatttgaacaga
tacacagtgaccgtggaaggaatgataaaactcgctttgtccacagcaagtggacttgcc
catcttcacatggagattgttggtacccaagggaaaccagccattgctcatagagatttg
aagtccaagaatatcttagtaaagaagaatggaacttgctgcattgcagacttaggactg
gcagtaagacacgattcagccacagatacgattgatattgctccaaaccacagagtggga
acaaaaaggtacatggcccccgaagttctagatgattccataaacatgaaacactttgaa
tccttcaaacgtgctgacatctatgcaatgggcttagtattctgggaaatagctcgacga
tgttccattggtggaattcatgaagattaccagctgccttattatgatcttgtaccttct
gatccatcagttgaagaaatgagaaaagttgtttgtgaacagaagttaaggccaaatatt
ccaaacagatggcagagttgtgaagccttgagagtaatggctaaaattatgagagaatgt
tggtatgccaacggagctgctagacttacagctttgaggattaagaaaacattgtcacaa
ctcagtcaacaggaaggcatcaaaatgtag

DBGET integrated database retrieval system