KEGG   Acinonyx jubatus (cheetah): 106972154Help
Entry
106972154         CDS       T04657                                 

Gene name
DHFR
Definition
(RefSeq) dihydrofolate reductase isoform X3
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju00670  One carbon pool by folate
aju00790  Folate biosynthesis
aju01100  Metabolic pathways
aju01523  Antifolate resistance
Brite
KEGG Orthology (KO) [BR:aju00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    106972154 (DHFR)
   00670 One carbon pool by folate
    106972154 (DHFR)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    106972154 (DHFR)
Enzymes [BR:aju01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     106972154 (DHFR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-GeneID: 106972154
NCBI-ProteinID: XP_014924567
Position
Unknown
AA seq 129 aa AA seqDB search
MVRPLNCIVAVSQNMGIGKNGDLPWPPLRNEFKYFQRMTTTSSVEGKQNLVIMGRKTWFS
IPEKNRPLKDRINIVLSRDLKEPPQGAHFLAKSLDDALELTEQPELAHKVDMVWVVGGSS
VYKIPRCSF
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atggttcgtccgctaaactgtatcgtcgctgtgtcccagaacatgggcatcggcaagaac
ggggacctgccctggccgccgctgaggaatgaattcaagtatttccaaaggatgaccaca
acctcatccgtagaaggtaaacagaatttggtgattatgggtagaaagacatggttctct
attccggagaagaatcgacctttaaaggacagaattaatatagttctcagtagagacctc
aaggaacctccacaaggagctcattttcttgccaaaagtctggatgatgccttagaactt
actgagcaaccagaattagcacataaagtggacatggtttgggtagtgggaggcagttct
gtttataagatacccaggtgttctttctga

DBGET integrated database retrieval system