KEGG   Acinonyx jubatus (cheetah): 106973349Help
Entry
106973349         CDS       T04657                                 

Gene name
DNASE2B
Definition
(RefSeq) deoxyribonuclease-2-beta isoform X1
  KO
K01158  deoxyribonuclease II [EC:3.1.22.1]
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04142  Lysosome
Brite
KEGG Orthology (KO) [BR:aju00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    106973349 (DNASE2B)
Enzymes [BR:aju01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.22  Endodeoxyribonucleases producing 3'-phosphomonoesters
    3.1.22.1  deoxyribonuclease II
     106973349 (DNASE2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNase_II Topo_Zn_Ribbon
Motif
Other DBs
NCBI-GeneID: 106973349
NCBI-ProteinID: XP_014925891
Position
Unknown
AA seq 357 aa AA seqDB search
MTARLLRTALPLLFFALFGVLEATTISCRNEEGKAVDWFAFYKLPKRQDKESRQTGLEYL
YLDSTTRSWRRSKQLMNTTNSVLGRTLQQLYEAYASENNNTAYLIYNDGVPTSVNYSRKY
GHTKGLLLWNRVQGFWLIHSIPRFPPAPEEGYDYPPTGRRHGQSGICITFKYNQYEAIDS
QLLVCNPNIYSCSIPAIFHQELVHMPQLCSRSSSSEIPDRHLTALQSARGQKFLHFAKSG
SFLDDIFAAWMAQRLKTHLLTETWQRKRQELPSNCSLPYHVYNVKAIKISGHSYFSSYQD
HAKWCVSQKRTKNRWTCIGDLNRSPYQAFRNGGFICTQNQHIYHAFQGLVLYYENCN
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgacagccagacttctaagaacagcccttcctttgctcttcttcgccctctttggggtc
ctggaggcgacaacaatatcgtgcagaaatgaagaaggcaaagctgtggattggtttgcc
ttttataagttacctaaaaggcaagacaaggaaagcagacagacggggttagagtaccta
tacctagactctacaaccaggagctggaggaggagtaagcaattaatgaataccaccaac
agtgtgttgggaaggacattacaacagctctatgaagcatatgcctccgagaataacaac
acagcctatctaatatacaatgatggagtccctacatctgtgaattacagcagaaagtat
ggacacactaaaggtttactgctgtggaaccgagtgcagggattttggctaattcattct
attcccagatttcctccagctcctgaagaaggctatgattatccacccacagggaggaga
catggacaatctggcatctgcataacttttaagtacaaccagtatgaagcaatagattct
cagctcttggtctgtaacccaaacatttatagctgttccatcccagccatctttcaccag
gagctcgttcatatgccccagctgtgctccagatccagctcatcagagatccctgaccgg
cacctcactgcacttcagtcagcccggggccaaaaattcctccattttgcaaagtctggt
tcttttcttgacgacatctttgcagcctggatggctcaacggttgaagacgcatttgcta
acagaaacctggcagcgaaagagacaagagcttccttcaaactgctcccttccttaccat
gtctacaatgtcaaagcaattaagatatctgggcactcttatttcagttcttaccaggat
catgccaaatggtgtgtttcccaaaagaggaccaaaaatcgctggacctgcattggagac
ctaaatcggagcccataccaagccttcagaaatggaggattcatttgtacccagaatcag
catatttaccatgcatttcaaggattggttttgtattatgagaactgcaactaa

DBGET integrated database retrieval system