KEGG   Acinonyx jubatus (cheetah): 106975898Help
Entry
106975898         CDS       T04657                                 

Gene name
ATG16L1
Definition
(RefSeq) autophagy-related protein 16-1 isoform X1
  KO
K17890  autophagy-related protein 16-1
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04136  Autophagy - other
aju04140  Autophagy - animal
aju04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:aju00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106975898 (ATG16L1)
   04136 Autophagy - other
    106975898 (ATG16L1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    106975898 (ATG16L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:aju04131]
    106975898 (ATG16L1)
   03029 Mitochondrial biogenesis [BR:aju03029]
    106975898 (ATG16L1)
Membrane trafficking [BR:aju04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    106975898 (ATG16L1)
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    106975898 (ATG16L1)
Mitochondrial biogenesis [BR:aju03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    106975898 (ATG16L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATG16 WD40 ANAPC4_WD40 eIF2A Nup160 ZapB Fez1 TolB_like
Motif
Other DBs
NCBI-GeneID: 106975898
NCBI-ProteinID: XP_026903210
Position
Unknown
AA seq 623 aa AA seqDB search
MSSGLRAADFPRWKRHISEELRRRDRLQRQAFEEIILQYNKLLEKSDLHSVLAHKLQAEK
HDVPNRHEISPGHDGAWNDGQLQEMAQLRIKHQEELTELHKKRGELAQLVIDLNNQMQQK
DREMQMNEAKIAECLQTISDLETECQELRGKLQDLERANQTLKDEYDALQITFTALEEKL
RKTTEENQELVTRWMAEKAQEANRLNAENEKDSRRRQARLQKELAEAAKEPLPVEQDDDI
EVIVDETSDHAEETSPVRAISRAATKRLSQPAGGLLDSITNIFGLSESPLLGHHSSDAAR
RRSVSSFPVPQDNVDTHPGSSKEVRVPTTAICVFDAHDGEVNAVQFSPGSRLLATGGMDR
RVKLWEVFGDKCEFKGSLSGSNAGITSIEFDSAGSYLLAASNDFASRIWTVDDYRLRHTL
TGHSGKVLSAKFLLDNARIVSGSHDRTLKLWDLRSKVCIKTVFAGSSCNDIVCTEQCVMS
GHFDKKIRFWDIRSESIVREMELLGKVTALDLNPERTELLSCSRDDLLKIIDLRVNAVRQ
TFSAPGFKCGSDWTRVVFSPDGGYVAAGSAEGSLYVWSVLSGKVEKVLSKQHGSSINAVA
WSPSGSHVVSVDKGSKAVLWSEY
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcgggcctccgcgccgccgacttcccccgctggaagcgccacatttcggaggag
ctgaggcggcgggaccggctgcagaggcaggcatttgaagagatcatcctgcagtataac
aagttgctagaaaagtcagatcttcattcagtgctggcccataagctacaagctgaaaag
catgacgtccccaacaggcatgagataagtcctggccacgacggtgcatggaatgatggt
cagctacaagaaatggcccagctgaggattaaacaccaagaagaactgactgaattacac
aagaaacgtggggagttagctcagttggtgattgacctgaataaccaaatgcagcagaag
gatagggagatgcagatgaatgaagcaaaaattgcagagtgcttgcagaccatctctgac
ctggagacggagtgccaagaactgcgtggtaagcttcaggacctcgaaagagccaaccag
accctgaaggatgagtatgatgccctgcagatcacgtttactgccttggaggagaaactg
aggaaaactactgaagagaaccaggagctggtcaccagatggatggccgagaaagcccag
gaagccaaccgcctcaatgcagagaatgagaaggattcaaggcggcggcaagcccggctg
cagaaagagcttgcagaagcggcaaaggaacctctacccgttgaacaggatgatgacatt
gaagtcatcgtggatgaaacctctgatcacgccgaggagacttctcctgtgcgagccatc
agcagagcggccactaagcgactctcgcagcctgctggaggccttctggattctatcact
aatatctttggtctgtctgagtctccccttctgggacatcactcttctgatgctgccagg
aggcgctctgtctcttcctttccagttccccaggataacgtggatactcatcctggttct
agtaaagaagtgagggtgccaacgaccgccatatgtgtctttgacgctcatgatggggaa
gtcaacgctgtgcagttcagtccaggctcccggttgctggccacaggaggcatggatcgg
agagttaagctttgggaagtgtttggagataaatgtgagttcaagggctccctgtccggc
agtaatgcaggaattacaagcattgaatttgacagtgctggatcttacctcttagcagct
tcaaatgattttgcaagtcgaatctggactgtggatgattatcggttacggcacacgctc
acaggacacagcggcaaagtgctgtctgccaagttcctgctggacaacgcgcgcattgtt
tccggaagtcatgaccggaccctcaagctctgggatctccgcagcaaagtctgcataaag
accgtgtttgcaggatccagctgcaacgatatcgtctgcacagagcagtgtgtgatgagt
ggacacttcgacaagaaaattcgtttctgggacatccgatcggagagcatcgtccgggag
atggagctgctgggcaaagtcactgccctggacttaaacccggagagaaccgaactcctc
agctgctctcgcgatgatcttctaaaaatcatcgatcttcgagtaaatgccgtcagacag
acgtttagcgcccctgggttcaagtgcggctctgattggaccagagttgtgttcagccct
gacggtggttacgtggcagcgggctcggctgagggctccctctacgtctggagcgtgctc
tcggggaaagtggagaaggtcctttcaaagcagcatggctcgtccatcaatgcagtggcg
tggtccccctccggctcccacgtggtcagtgtggacaaaggaagcaaagctgtgctgtgg
tcagaatattga

DBGET integrated database retrieval system