KEGG   Acinonyx jubatus (cheetah): 106978014Help
Entry
106978014         CDS       T04657                                 

Gene name
NDUFS3
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial
  KO
K03936  NADH dehydrogenase (ubiquinone) Fe-S protein 3 [EC:7.1.1.2 1.6.99.3]
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju00190  Oxidative phosphorylation
aju01100  Metabolic pathways
aju04714  Thermogenesis
aju04723  Retrograde endocannabinoid signaling
aju04932  Non-alcoholic fatty liver disease (NAFLD)
aju05010  Alzheimer disease
aju05012  Parkinson disease
aju05016  Huntington disease
Module
aju_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:aju00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    106978014 (NDUFS3)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    106978014 (NDUFS3)
  09159 Environmental adaptation
   04714 Thermogenesis
    106978014 (NDUFS3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    106978014 (NDUFS3)
   05012 Parkinson disease
    106978014 (NDUFS3)
   05016 Huntington disease
    106978014 (NDUFS3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    106978014 (NDUFS3)
Enzymes [BR:aju01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.99  With unknown physiological acceptors
    1.6.99.3  NADH dehydrogenase
     106978014 (NDUFS3)
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     106978014 (NDUFS3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Complex1_30kDa
Motif
Other DBs
NCBI-GeneID: 106978014
NCBI-ProteinID: XP_014931110
Position
Unknown
AA seq 265 aa AA seqDB search
MAATAAAARGWWRGLVGSVALARVAGRPSVLLLPVRRESVAADTRPTVRPRNDVAHKQLS
AFGEYVAEILPKYVQQVQVSCFNELEICIHPDGVIPVLTFLRDHTNAQFKSLADLTAVDV
PTRQNRFEIVYNLLSLRFNSRIRVKTYTDELTPIESTVPVYKAANWYEREIWDMFGVFFA
NHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPW
EAFPAYRQPPESLKLEAGDKKPETK
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgacggcggctgctgcgaggggctggtggcggggtctcgtagggtccgtggcg
ttggccagggtggccgggcgaccctcggtgctgttgctgccggtgaggagggaaagcgtc
gcggcagacacgcgccccactgtccgaccacggaatgatgtggcccacaagcagctctca
gcttttggagagtatgtggctgaaatcctgcccaagtatgtccaacaagttcaggtgtct
tgcttcaacgagttagagatctgtatccatcctgacggagtcatcccagtgctgactttc
ctcagggatcacaccaatgcacagttcaaatccttggctgacttgacagcagtggacgtc
cccacccggcaaaaccgttttgagattgtttacaacctgctctctctgcgcttcaactcc
cggatccgtgtgaagacctacacagatgagctgacacccattgagtccactgtacctgtg
tataaggcagctaactggtatgagagggagatctgggacatgtttggagttttttttgct
aaccatcctgatctaaggaggatcctgacagactatggctttgagggacatcctttccgg
aaagactttcccctatctggctacgttgagttacgctatgacgatgaggtgaagcgggtg
gtggctgagccagtggagttggcccaggagttccgcaagtttgacctgaacagcccttgg
gaggctttccctgcctatcggcagccccctgaaagtctcaagctcgaagctggggacaag
aaacctgaaaccaagtag

DBGET integrated database retrieval system