KEGG   Acinonyx jubatus (cheetah): 106978386Help
Entry
106978386         CDS       T04657                                 

Gene name
ERLIN2
Definition
(RefSeq) erlin-2
  KO
K23341  erlin
Organism
aju  Acinonyx jubatus (cheetah)
Brite
KEGG Orthology (KO) [BR:aju00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:aju04121]
    106978386 (ERLIN2)
Ubiquitin system [BR:aju04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ERAD complex
    106978386 (ERLIN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Band_7 DUF4346 RapA_C POR_N
Motif
Other DBs
NCBI-GeneID: 106978386
NCBI-ProteinID: XP_014931574
Position
Unknown
AA seq 337 aa AA seqDB search
MAQLGAVVAVASSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYK
SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNKI
HHELNQFCSVHTLQEVYIELFDQIDENLKLALQQDLTSMAPGLVIQAVRVTKPNIPEAIR
RNYELMESEKTKLLIAAQKQKVVEKEAETERKKALIEAEKVAQVAEITYGQKVMEKETEK
KISEIEDAAFLAREKAKADAECYTAMKIAEANKLKLTPEYLQLMKYKAIASNSKIYFGKD
IPNMFMDSAGGLGKQFEGLADKLSFDDDPLEADPEEN
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggctcagttgggagcagttgtggctgtggcttccagtttcttttgtgcgtctcttttc
tcagctgtgcacaagatagaagagggacatattggggtgtattacagaggcggtgcccta
ctgacttccaccagtggccctggtttccatctcatgctccctttcatcacatcatataag
tctgtgcagaccacactgcagacagatgaggtgaagaacgtgccttgcgggactagtggt
ggtgtaatgatctactttgacagaattgaagtggtgaacttcttggtcccaaacgcagtg
tatgacatagtgaagaactacactgctgactacgacaaggccctcatcttcaacaagatc
caccacgaactgaaccagttctgcagcgtgcatacgcttcaggaggtctacatcgagctc
tttgatcagattgatgaaaatctcaagctggctttgcaacaggacctgacctccatggcc
cccgggctcgtcatccaagctgtgcgggtgacaaagcccaatatacccgaggcgatccgc
agaaactacgagttgatggaaagcgagaagacaaagctgctcattgcagcccagaaacag
aaggtggtggagaaggaagctgagacagagcgcaagaaggccctgatcgaggcagaaaaa
gtggctcaggtggcagaaatcacctatgggcagaaggtgatggagaaggagaccgagaaa
aagatttcggaaattgaagatgctgcctttctggcccgggagaaggcaaaggctgatgcc
gagtgctacaccgctatgaaaatcgctgaagcaaacaagctgaagctgacccctgagtat
ttgcagctgatgaagtacaaagccattgcttccaacagcaagatttactttggcaaagac
atcccgaacatgttcatggactccgcaggcggtctgggcaagcagttcgaggggctagct
gacaagctgagtttcgatgatgaccccttggaagcagaccctgaggagaattga

DBGET integrated database retrieval system