KEGG   Acinonyx jubatus (cheetah): 106978517Help
Entry
106978517         CDS       T04657                                 

Gene name
ATP1A4
Definition
(RefSeq) sodium/potassium-transporting ATPase subunit alpha-4 isoform X1
  KO
K01539  sodium/potassium-transporting ATPase subunit alpha [EC:7.2.2.13]
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04022  cGMP-PKG signaling pathway
aju04024  cAMP signaling pathway
aju04260  Cardiac muscle contraction
aju04261  Adrenergic signaling in cardiomyocytes
aju04911  Insulin secretion
aju04918  Thyroid hormone synthesis
aju04919  Thyroid hormone signaling pathway
aju04925  Aldosterone synthesis and secretion
aju04960  Aldosterone-regulated sodium reabsorption
aju04961  Endocrine and other factor-regulated calcium reabsorption
aju04964  Proximal tubule bicarbonate reclamation
aju04970  Salivary secretion
aju04971  Gastric acid secretion
aju04972  Pancreatic secretion
aju04973  Carbohydrate digestion and absorption
aju04974  Protein digestion and absorption
aju04976  Bile secretion
aju04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    106978517 (ATP1A4)
   04022 cGMP-PKG signaling pathway
    106978517 (ATP1A4)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    106978517 (ATP1A4)
   04918 Thyroid hormone synthesis
    106978517 (ATP1A4)
   04919 Thyroid hormone signaling pathway
    106978517 (ATP1A4)
   04925 Aldosterone synthesis and secretion
    106978517 (ATP1A4)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    106978517 (ATP1A4)
   04261 Adrenergic signaling in cardiomyocytes
    106978517 (ATP1A4)
  09154 Digestive system
   04970 Salivary secretion
    106978517 (ATP1A4)
   04971 Gastric acid secretion
    106978517 (ATP1A4)
   04972 Pancreatic secretion
    106978517 (ATP1A4)
   04976 Bile secretion
    106978517 (ATP1A4)
   04973 Carbohydrate digestion and absorption
    106978517 (ATP1A4)
   04974 Protein digestion and absorption
    106978517 (ATP1A4)
   04978 Mineral absorption
    106978517 (ATP1A4)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    106978517 (ATP1A4)
   04961 Endocrine and other factor-regulated calcium reabsorption
    106978517 (ATP1A4)
   04964 Proximal tubule bicarbonate reclamation
    106978517 (ATP1A4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aju04147]
    106978517 (ATP1A4)
Enzymes [BR:aju01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.13  Na+/K+-exchanging ATPase
     106978517 (ATP1A4)
Exosome [BR:aju04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   106978517 (ATP1A4)
  Exosomal proteins of other body fluids (saliva and urine)
   106978517 (ATP1A4)
  Exosomal proteins of colorectal cancer cells
   106978517 (ATP1A4)
  Exosomal proteins of bladder cancer cells
   106978517 (ATP1A4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Cation_ATPase Hydrolase Cation_ATPase_N Hydrolase_3
Motif
Other DBs
NCBI-GeneID: 106978517
NCBI-ProteinID: XP_026904446
Position
Unknown
AA seq 1074 aa AA seqDB search
MGRQRKRGTVIPHEQILRPRHKKRHKSGKRRKMKRKTMKADMEELKKEVVMDDHKLTLEE
LSTKYSVDLTKGLSAKKAQEILNRDGPNVLTPPPTVSEWVKFCKQLFGGFSILLWMGAIL
CFVAYGIQMHFKEDLSRDNLYLGIVLSFVVIITGCFSYYQEAKSSKIMESFKNMVPQQAL
VIRDGEKIQINVENVVVGDLVEVKGGDRIPADLRLISAQGCKVDNSSLTGESEPQSRSPD
FSHENPLETRNICFFSTNCVEGTARGVVIATGDSTVMGRIASLTSGLETGKTPIAVEIEH
FIHLITAVAIFLGVSFFGLSLSLGYGWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKR
MAHKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDETIYEADTSEEQTGKT
FAKGSATWFVLARIAGLCNRADFKANQETLPIVKRATTGDASESALLKFIEHSYSSVKEM
REKNPKVAEIPFNSTNKYQMSIHLQEESSQPHVLMMKGAPERILEFCSTYLLNGEEYPID
EKMKSKFQDAYLELGGLGERVLGFCFLNLPTTFSKGFKFDTDEINFPMEDLCFVGLISMI
DPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGARTIDNVAAQLKVPV
CSSIDPREAKAIVVHGSDLKDMTSEQLDEILRNHTEIVFARTSPQQKLIIVEGCQRQGAI
VAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDN
LKKSIAYTLTSNIPEITPFLLFIILSIPLPLGTITILCIDLGTDMVPAISLAYESAESDI
MKRAPRNPKTDNLVNHRLIGMAYGQIGMIQALAGFFTYFVILAENGFRPLDLLGIRLNWE
NRFLNDLEDSYGQQWTYEQRKVVEFTCHTAFFVSIVVVQWADLIICKTRRNSIFQQGMKN
NILIFGLMEETFLAVFLSYTPGMDMALRMYPLKPVRLCLGVFWFFYIGVRLLRRCSIATF
TGKKKQTCHTTPLSSPCPPLQWSRACSSSSSAMNSHTLLTFPSLAVFHTTLCGL
NT seq 3225 nt NT seq  +upstreamnt  +downstreamnt
atggggcgccagagaaaaagggggaccgtgatccctcacgagcagatcctaaggccaaga
cataaaaagaggcataaatcggggaagagaagaaaaatgaagaggaaaacaatgaaggca
gacatggaggaactgaagaaggaagtggtcatggacgatcacaaattaaccctggaagag
ctgagcaccaagtactccgtggacctgacgaagggccttagcgccaaaaaggcacaggaa
atcttgaaccgagatggacccaacgtgcttacgccgccccccaccgtttcggaatgggtc
aagttctgtaaacaactcttcggtggcttctccatcttactgtggatgggtgccattctc
tgcttcgtggcctatggcatccagatgcatttcaaggaggatctttccagagataatctg
tacctgggcatcgtactgtccttcgtggtcatcatcaccggctgcttctcctactaccag
gaggccaagagctccaagatcatggagtctttcaagaacatggtgcctcagcaagctttg
gtgattcgggatggagagaagatacagatcaacgtagagaacgtggtggtgggagacttg
gtggaggtgaagggcggagaccgaatccctgcggacctccggctcatctctgcacaagga
tgtaaggtggacaactcctccttgactggagagtcagagccccagtcccgctcccctgac
ttcagccacgagaaccctctggagactcgtaacatctgcttcttctccaccaactgcgtg
gaaggaacagcccggggcgttgtgatagcaacgggagactccacagtgatgggccgcatc
gcctccctgacgtcaggcctggagacgggcaagacccccatcgctgtggagatcgaacac
ttcatccatctgatcacggcggtggccatcttccttggcgtctctttcttcgggctctcg
ctcagcttgggctacggctggctggaggctgtcatttttctcatcggcatcattgtggcc
aatgtgcccgaggggctgctggccaccgtcactgtgtgtctgaccctgaccgccaagcgc
atggcgcacaagaactgcctggtgaagaacctggaggcggtggagacgctgggctccacc
tctaccatctgctcggacaagacggggaccctcacccagaaccgcatgaccgtcgcccac
atgtggttcgatgagaccatctacgaggcggacaccagcgaagagcagactgggaaaacg
tttgccaagggctcagctacctggttcgtcctggcccgaatcgccggcctctgcaaccga
gctgactttaaggctaaccaggagacccttcccatcgtcaagcgagccacaacaggcgat
gcttctgagtcggccctcctcaagttcatcgagcattcgtacagctctgtgaaggagatg
agagagaaaaaccccaaggtggccgagattccctttaattccaccaacaagtaccagatg
tccatccacctgcaggaggagagctcccagccccacgtgctgatgatgaagggggccccc
gagaggatcctggagttttgctccacgtaccttctgaacggagaggagtaccccatagac
gagaagatgaagagcaagttccaggacgcctatctggagctgggaggcctgggggagcgc
gtgctcggcttctgtttcttgaatctgcccaccactttctccaagggattcaagtttgac
acggatgagatcaatttccccatggaggacctttgctttgtgggcctcatctccatgatt
gaccctccccgggccgccgtgcccgacgccgtgggcaagtgtcgcagtgcggggattaag
gtgattatggtaacaggggatcatcccattacagccaaggccatagccaaaggggtgggc
atcatctctgaaggcgctagaacaatagacaacgtggccgcccagctcaaggtccccgtc
tgcagcagcatcgaccccagggaagccaaggccatcgtggtgcacggctcggacctgaag
gacatgacgtcggagcagctggacgagatcctcaggaaccacacggagatcgtgttcgcg
cggacgtccccgcaacagaaactcatcatcgtggagggctgtcagaggcagggggccatc
gtggcggtgacgggggacggcgtgaacgactcccccgcgctgaagaaggctgacatcggc
atcgccatgggcatctcgggctccgacgtgtcgaagcaggccgccgacatgatcctgctg
gacgacaacttcgcctccatcgtcacgggcgtggaggagggccgcctcatctttgacaac
ctgaagaaatccatcgcgtacaccctgaccagcaacatccccgagatcacccccttcctg
ctcttcatcatcctcagcatccccctgcctctgggcaccatcaccatcctctgcatcgac
ctgggcacagacatggtcccggccatctccttggcttacgagtcagctgaaagtgacatc
atgaagagggccccgcggaatccaaagactgataacctggtgaaccaccgtctcattggc
atggcctacggacagattgggatgatccaggctctggctggcttcttcacctacttcgtg
atcctggccgagaatggtttcagacctcttgatctgctgggcatccgtctcaactgggaa
aacagattcctcaatgacctggaggacagttacggacagcaatggacctacgagcagcgg
aaggtggtggagttcacgtgccacacggccttctttgtcagcatcgtggtcgtgcagtgg
gccgacctcatcatctgcaagacccgccgtaactccatcttccagcagggcatgaaaaac
aacatcctaatatttgggctcatggaggagacattcctggctgtttttctctcctacact
ccaggcatggacatggccttgcggatgtacccactcaagcccgtgcgtctgtgtcttggt
gtattttggtttttttacatcggcgtgcgcttgttacgaagatgttctatcgcgactttt
acagggaaaaaaaagcaaacgtgccataccaccccactctcatcgccctgcccgcctctg
caatggtctcgggcgtgttcgtccagctcatctgccatgaattcacacactttgctcacc
tttccgtcccttgcagtgtttcacacaacgctttgtgggctgtag

DBGET integrated database retrieval system