KEGG   Acinonyx jubatus (cheetah): 106979040Help
Entry
106979040         CDS       T04657                                 

Gene name
INSR
Definition
(RefSeq) insulin receptor
  KO
K04527  insulin receptor [EC:2.7.10.1]
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04010  MAPK signaling pathway
aju04014  Ras signaling pathway
aju04015  Rap1 signaling pathway
aju04022  cGMP-PKG signaling pathway
aju04066  HIF-1 signaling pathway
aju04068  FoxO signaling pathway
aju04072  Phospholipase D signaling pathway
aju04150  mTOR signaling pathway
aju04151  PI3K-Akt signaling pathway
aju04152  AMPK signaling pathway
aju04211  Longevity regulating pathway
aju04213  Longevity regulating pathway - multiple species
aju04520  Adherens junction
aju04910  Insulin signaling pathway
aju04913  Ovarian steroidogenesis
aju04923  Regulation of lipolysis in adipocytes
aju04930  Type II diabetes mellitus
aju04931  Insulin resistance
aju04932  Non-alcoholic fatty liver disease (NAFLD)
aju04960  Aldosterone-regulated sodium reabsorption
Module
aju_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    106979040 (INSR)
   04015 Rap1 signaling pathway
    106979040 (INSR)
   04010 MAPK signaling pathway
    106979040 (INSR)
   04066 HIF-1 signaling pathway
    106979040 (INSR)
   04068 FoxO signaling pathway
    106979040 (INSR)
   04072 Phospholipase D signaling pathway
    106979040 (INSR)
   04022 cGMP - PKG signaling pathway
    106979040 (INSR)
   04151 PI3K-Akt signaling pathway
    106979040 (INSR)
   04152 AMPK signaling pathway
    106979040 (INSR)
   04150 mTOR signaling pathway
    106979040 (INSR)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    106979040 (INSR)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    106979040 (INSR)
   04923 Regulation of lipolysis in adipocyte
    106979040 (INSR)
   04913 Ovarian Steroidogenesis
    106979040 (INSR)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    106979040 (INSR)
  09149 Aging
   04211 Longevity regulating pathway - mammal
    106979040 (INSR)
   04213 Longevity regulating pathway - multiple species
    106979040 (INSR)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    106979040 (INSR)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    106979040 (INSR)
   04931 Insulin resistance
    106979040 (INSR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aju01001]
    106979040 (INSR)
  09183 Protein families: signaling and cellular processes
   04090 CD Molecules [BR:aju04090]
    106979040 (INSR)
Enzymes [BR:aju01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     106979040 (INSR)
Protein kinases [BR:aju01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   106979040 (INSR)
CD molecules [BR:aju04090]
 Proteins
  106979040 (INSR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Recep_L_domain Pkinase Furin-like fn3 Kinase-like B2 DUF4476
Motif
Other DBs
NCBI-GeneID: 106979040
NCBI-ProteinID: XP_014932285
Position
Un
AA seq 1340 aa AA seqDB search
MDIRNNLTRLHELANCSVIEGHLQILLMFKTRPEDFRDLSFPKLVMITDYLLLFRVYGLE
SLKDLFPNLTVIRGSRLFFNYALVIFEMVHLKELGLYSLMNITRGSVRIEKNNELCYLAT
IDWSRILDSVEDNYIVLNKDDNEECGDICPGTAKGKTSCPATVINGQFVERCWTHGHCQK
VCPTICKSHGCTADGLCCHSECLGNCSEPDDPTKCVACRNFYLDGRCVETCPPPYYHFQD
WRCVNFSFCRDLHNKCKNSRRQGCHQYVIHNNRCIPECPSGYTMNSSNLMCTPCLGPCPK
VCHILEGEKTIDSVTSAQELRGCTVVNGSLIINIRGGNNLAAELEANLGLIEEISGYLKI
RRSYALVSLSFFRKLRLIRGETLEIGNYSFYALDNQNLRQLWDWSKHNLTITQGKLFFHY
NPKLCLSEIHKMEEVSGTKGRQERNDIALKTNGDQASCENELLKFSYIRTSYDKILLKWE
PYWPPDFRDLLGFMLFYKEAPYQNVTEFDGQDACGSNSWDPPLRSNDPKSQNHPGWLMRG
LKPWTQYAIFVKTLVTFSDERRTYGAKSDIIYVQTDATNPSVPLDPISVSNSSSQIILKW
KPPSDPNGNITHYLVFWERQAEDSELYELDYCLKGLKLPSRTWSPPFESEGSQKHNQSEY
EESAGECCSCPKTDSQILKELEESSFRKTFEDYLHNVVFVPRKSFSSPGAEDSRPSRKRR
ALADAGNVTAAVPTVPGFPNTSSSVPTSPEEHKPFEKVVNKESLVISGLRHFTGYRIELQ
ACCTQDAPEERCSVAAYVSARTMPEAKADDIVGPVTHEIFENNVVHLMWQEPKEPNGLIV
LYEVSYRRYGDEELHLCVSRRHFALERGCRLRGLPPGNYSVRVRATSLAGNGSWTEATYF
YVTDYLDVPSNIAKIIIGPLIFVFLFSVVIGSIYLFLRKRQPDGPLGPLYASSNPEYLSA
SDVFPCSVYVPDEWEVPREKITLLRELGQGSFGMVYEGNARDIVKGEAETRVAVKTVNES
ASLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMVHGDLKSYLRSLRPGA
ENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTR
DIYETDYYRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSN
EQVLKFVMDGGYLDQPDNCPERVTDLMHMCWQFNPKMRPTFLEIVDLLKDDLHPSFPEVS
FFHSEENKAPESEELEMEFEDMESVPLDRASHSQREEAGGRDGVSSLGLKRNYEDHIPYT
HMNGGKKNGRILTLPRSNPS
NT seq 4023 nt NT seq  +upstreamnt  +downstreamnt
atggatatccggaacaacctgacgaggctgcacgaactggccaactgctcggtcattgaa
ggtcatttgcagatactgctcatgttcaaaacgaggcccgaggacttccgagacctcagt
ttccccaaactcgtcatgatcactgattacctgctgctcttccgggtgtacgggctggag
agcctgaaggacctcttccccaacctcacggtcatccggggctcgcgcctcttcttcaac
tacgcgctggtcatcttcgagatggtgcacctgaaggagcttggtctctacagcttgatg
aacattacccggggctccgtccgcatcgagaagaataatgagctgtgctacctggccacc
atcgactggtcgcgcatcctggattcggtggaggataattacattgtattgaacaaagac
gacaacgaggagtgtggggacatttgtccaggcactgcaaagggcaagaccagctgccct
gccactgtcatcaacgggcagtttgtggagcgttgttggacacacggccattgccagaaa
gtttgtccgaccatctgcaagtcgcacggctgcacggccgacggcctctgctgccacagc
gagtgtttgggcaactgctccgagcccgacgaccccaccaagtgcgtggcctgtcgcaac
ttctacctggacggcaggtgcgtggagacctgcccgcccccctactaccacttccaagac
tggcgctgcgtgaacttcagcttctgccgggacctgcacaataaatgcaagaactcccgg
agacagggttgccaccagtatgtcattcacaacaacaggtgcatccctgagtgcccctcg
gggtacacgatgaattccagcaacctgatgtgtactccctgcctgggcccctgtcccaag
gtctgccacatcctggaaggcgagaagaccatcgactcggtgacatctgcccaggagctc
cgaggctgcaccgtcgtcaacggaagcctaatcatcaacattcgagggggcaacaacctg
gcagctgagctggaggccaacctcggactcattgaagaaatttccgggtatctgaagatc
cggagatcctatgctctcgtgtcactctcctttttccggaagttacggctgattcgggga
gagaccttggaaatcgggaactactctttctatgccttggacaaccagaacctgaggcag
ctatgggactggagcaaacacaacctcaccatcactcaggggaaactcttcttccactat
aatcccaaactctgcttgtcggaaattcacaagatggaggaggtttcaggaaccaagggg
cgccaggagcggaacgacattgccctgaagaccaatggggaccaggcgtcttgtgaaaat
gaactacttaaattttcttacattcggacatcttacgacaagatcttgctgaaatgggag
ccgtactggccccctgacttccgagacctccttggcttcatgctcttctacaaagaggcc
ccttatcagaatgtgaccgagttcgacgggcaggacgcgtgtggctccaacagctgggac
ccgcctctgaggtccaatgaccccaagtcgcagaaccacccagggtggctgatgcggggt
ctcaagccctggacccagtatgccatctttgtcaagaccttggtcaccttttctgatgag
cgccgcacgtatggggccaagagtgacatcatctatgtccagaccgatgccaccaaccct
tccgtccccctggatcctatctcggtttcgaattcctcctctcagatcattctgaagtgg
aagcctccctcggaccccaacggcaacatcacgcactacctggtgttctgggagaggcag
gcggaggacagcgagctatatgagttggattattgcctcaaagggttgaagctgccttcc
cggacctggtccccgccgttcgagtccgagggctcccagaagcacaatcagagtgagtac
gaggagtccgctggcgagtgctgctcgtgtcccaaaaccgactctcagatcctgaaggag
ctggaggagtcctctttcaggaagacgttcgaggattacctgcacaatgtggttttcgtg
cccagaaaatccttttcaagccctggtgctgaggacagtaggccatcgcggaagcgcagg
gccctcgccgacgctgggaacgtgacggccgccgtgcccacggtgcctggtttccccaac
acttccagcagcgtgcccacgagcccggaagagcacaagcccttcgagaaggtggtgaac
aaagagtcgctggtcatctctggcctgcgtcacttcactggctaccgcatcgagctgcag
gcttgctgcacccaagatgcccccgaggagaggtgcagcgtggctgcctacgtcagcgcc
aggaccatgcccgaagccaaggcagacgacattgttggccctgtgacccatgaaatcttc
gagaacaacgtggttcacttgatgtggcaagagcctaaagaacccaatggattgatcgtg
ctgtatgaagtgagttaccgacggtatggtgatgaggagctgcacctctgtgtctcccgt
agacactttgctctggagcggggctgcaggctgcgagggctgccgccggggaattacagt
gtgcgagttcgggccacctccctggcgggcaacggctcctggacagaagccacttatttc
tatgtgacagactatttagatgtcccatcgaacattgcaaaaattatcatcgggcctctc
atctttgtctttctcttcagtgttgtgattggaagtatttatctattcctgagaaagagg
cagccggatggcccactggggccgctgtatgcttcttcaaaccctgagtacctcagtgcc
agtgatgtgtttccctgctctgtgtatgtgccggacgagtgggaggtgcctcgggagaag
atcactctcctgcgcgagctggggcagggctccttcggcatggtgtacgagggcaatgcc
agggacatcgtcaagggcgaggcggagacccgcgtggcggtgaagacggtcaacgagtcc
gccagtctgcgagagaggatcgagtttctcaacgaggcctcagtcatgaagggcttcacc
tgtcatcacgtggtccgcctcctgggggtggtgtccaaaggccagccgacgctggtcgtg
atggagctgatggttcacggagacctgaagagctacctccgctccctgcggccgggggct
gagaataaccctggccgccctccccctactctgcaagagatgattcagatggcggcggag
atcgccgacgggatggcgtacctgaatgccaagaagtttgtgcaccgggatctcgcagcc
cgaaattgcatggtggcccacgacttcaccgtcaaaattggagacttcggaatgaccaga
gacatctatgaaacggattactaccggaaaggaggcaagggtctgctccccgtgcggtgg
atggcaccggaatccctgaaggacggggtcttcaccacttcttctgacatgtggtccttt
ggtgtggtcctttgggaaatcaccagcttggcggaacaaccttaccaaggcctgtctaat
gaacaggtgttgaaatttgtcatggacggaggatatttggaccaacctgacaactgtccg
gagagagtcaccgacctgatgcacatgtgctggcagttcaatcccaagatgcggcccacc
ttcctggagatcgttgacctgctcaaggacgacctgcaccccagctttccggaagtttcc
ttcttccacagcgaggagaacaaggcgcctgagagtgaggagttggaaatggagtttgag
gacatggagagtgtccccctggatcgggcctcacactcacagagggaagaggccgggggc
cgggatggagtgtcctcgctgggcctcaagcggaactacgaggaccacatcccctacacc
cacatgaacgggggcaagaaaaacggacggattctgaccctgccgaggtcgaatccttcc
taa

DBGET integrated database retrieval system