KEGG   Acinonyx jubatus (cheetah): 106979842Help
Entry
106979842         CDS       T04657                                 

Gene name
FASLG
Definition
(RefSeq) tumor necrosis factor ligand superfamily member 6
  KO
K04389  tumor necrosis factor ligand superfamily member 6
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju01524  Platinum drug resistance
aju04010  MAPK signaling pathway
aju04014  Ras signaling pathway
aju04060  Cytokine-cytokine receptor interaction
aju04068  FoxO signaling pathway
aju04151  PI3K-Akt signaling pathway
aju04210  Apoptosis
aju04217  Necroptosis
aju04650  Natural killer cell mediated cytotoxicity
aju04722  Neurotrophin signaling pathway
aju04932  Non-alcoholic fatty liver disease (NAFLD)
aju04940  Type I diabetes mellitus
aju05142  Chagas disease (American trypanosomiasis)
aju05143  African trypanosomiasis
aju05160  Hepatitis C
aju05161  Hepatitis B
aju05162  Measles
aju05163  Human cytomegalovirus infection
aju05164  Influenza A
aju05165  Human papillomavirus infection
aju05168  Herpes simplex virus 1 infection
aju05170  Human immunodeficiency virus 1 infection
aju05200  Pathways in cancer
aju05205  Proteoglycans in cancer
aju05320  Autoimmune thyroid disease
aju05330  Allograft rejection
aju05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    106979842 (FASLG)
   04010 MAPK signaling pathway
    106979842 (FASLG)
   04068 FoxO signaling pathway
    106979842 (FASLG)
   04151 PI3K-Akt signaling pathway
    106979842 (FASLG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    106979842 (FASLG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    106979842 (FASLG)
   04217 Necroptosis
    106979842 (FASLG)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    106979842 (FASLG)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    106979842 (FASLG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106979842 (FASLG)
   05205 Proteoglycans in cancer
    106979842 (FASLG)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    106979842 (FASLG)
   05330 Allograft rejection
    106979842 (FASLG)
   05332 Graft-versus-host disease
    106979842 (FASLG)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    106979842 (FASLG)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    106979842 (FASLG)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    106979842 (FASLG)
   05162 Measles
    106979842 (FASLG)
   05164 Influenza A
    106979842 (FASLG)
   05161 Hepatitis B
    106979842 (FASLG)
   05160 Hepatitis C
    106979842 (FASLG)
   05168 Herpes simplex virus 1 infection
    106979842 (FASLG)
   05163 Human cytomegalovirus infection
    106979842 (FASLG)
   05165 Human papillomavirus infection
    106979842 (FASLG)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    106979842 (FASLG)
   05143 African trypanosomiasis
    106979842 (FASLG)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    106979842 (FASLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aju04147]
    106979842 (FASLG)
   04052 Cytokines and growth factors [BR:aju04052]
    106979842 (FASLG)
   04090 CD molecules [BR:aju04090]
    106979842 (FASLG)
Exosome [BR:aju04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   106979842 (FASLG)
Cytokines and growth factors [BR:aju04052]
 Cytokines
  Tumor necrosis fators
   106979842 (FASLG)
CD molecules [BR:aju04090]
 Proteins
  106979842 (FASLG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF
Motif
Other DBs
NCBI-GeneID: 106979842
NCBI-ProteinID: XP_014933287
Position
Unknown
AA seq 280 aa AA seqDB search
MQQPLNYPYPQIYWVDSRASSPWGPPGSVLPCPSSVPGRPGQRRPPPPPPPTLPPPPPPP
PLPPLPLPPLKTRRDHNTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQK
HVASSLEKQIGQLNPPSEKRELRKVAHLTGKPNSRSIPLEWEDTYGIALVSGVKYKKGGL
VINDTGMYFVYSKVNFRGQSCNNQPLNHKVYMRNSKYPQDLVLMEGKMMNYCTTGQMWAR
SSYLGAVFNLTSADHLYVNVSELSLVSFEESKTFFGLYKL
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgcagcagcccctgaattacccatacccccaaatctactgggtggacagcagggccagt
tctccctggggccctccagggtcggtcctcccttgtccatcctctgtgccaggaaggcct
ggacaaaggaggccgccaccgccgccaccaccaacactaccaccaccaccaccgccacca
ccactgcccccactgccattgccacctctgaagacgaggagggaccacaacacagggctg
tgtcttcttgtgatgtttttcatggttctggtggccctggttggactggggctggggatg
tttcagctcttccacctccagaaggagctggctgaactcagagagtccaccagccaaaag
catgtagcatcatctttggagaagcaaataggtcaactcaatccaccctctgaaaaaagg
gagctgagaaaagtggcccatttaacaggcaagcccaactcaagatccatccctctggaa
tgggaagacacatatggaattgcccttgtctctggggtgaagtataagaagggtggcctt
gtgatcaatgacactgggatgtactttgtatattccaaagtgaacttcaggggtcagtcc
tgcaacaaccaacccctgaaccacaaggtctacatgaggaactctaagtatccccaggac
ctggtgctgatggaagggaagatgatgaactactgcactactggccagatgtgggcccgc
agcagctacctgggggcagtattcaatctcaccagtgctgaccatttatatgtcaatgta
tctgaattatctctggtcagttttgaggaatctaagacattttttggcttatataagctc
taa

DBGET integrated database retrieval system