KEGG   Acinonyx jubatus (cheetah): 106981517Help
Entry
106981517         CDS       T04657                                 

Gene name
FDPS
Definition
(RefSeq) farnesyl pyrophosphate synthase isoform X1
  KO
K00787  farnesyl diphosphate synthase [EC:2.5.1.1 2.5.1.10]
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju00900  Terpenoid backbone biosynthesis
aju01100  Metabolic pathways
aju05164  Influenza A
aju05166  Human T-cell leukemia virus 1 infection
Module
aju_M00367  C10-C20 isoprenoid biosynthesis, non-plant eukaryotes
Brite
KEGG Orthology (KO) [BR:aju00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    106981517 (FDPS)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    106981517 (FDPS)
   05164 Influenza A
    106981517 (FDPS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:aju01006]
    106981517 (FDPS)
Enzymes [BR:aju01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     106981517 (FDPS)
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     106981517 (FDPS)
Prenyltransferases [BR:aju01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   106981517 (FDPS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-GeneID: 106981517
NCBI-ProteinID: XP_026904105
Position
Unknown
AA seq 420 aa AA seqDB search
MPLSRWLRSVGVFWLPAPCWAPQERWLGSLLRPSLVHGGPAPGAWHGARCWCQAWTEEPR
ALYSSLRMNGNQKLDPYAQEKQNFIQHFSQIVKVLTEDGTGHPEIGDAVARLKEVLEYNA
VGGKYQRGLTVLIAYRQLVEPGKQDADSLRRALTVGWCVELLQAFFLVSDDIMDSSLTRR
GQVCWYQKPGIGLDAINDALLLEACIYRVLRLYCREQPYYLNLIELFLQSSYQTELGQTL
DLITAPQGNVDLSRFTEKRYKSIVKYKTAFYSFYLPVAAAMYMAGIDGEKEHASARKILL
EMGEFFQVQDDYLDLFGDPSVTGKIGTDIQDNKCSWLVVQCLQRASPEQRKVLQENYGQK
EAEKVARVKALYEELELPAVFGQYQEDSYGRLMGLIEQHSAPLPPAIFLGLAHKIYKRKK
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgcccctgtcccgctggctgagatctgtgggggtcttctggctgccagctccctgctgg
gcgccccaggagaggtggctgggttccctcctgcggccctccctggtgcacgggggccca
gccccgggggcctggcacggtgcccgctgctggtgccaagcgtggacagaggagcctcga
gcactttactcctccctcagaatgaatggaaaccagaaattggacccttatgcccaagaa
aagcagaatttcatccaacacttctcccagattgtcaaggtgctgaccgaggatggcacg
ggccacccagagataggagatgccgttgcccggctcaaggaggtcctggagtacaacgcc
gtcggaggcaagtaccagcggggcctgacggtgttgatagcctaccggcagctggtggag
cccgggaagcaggatgccgacagtctccggcgggccctgaccgtgggctggtgtgtggaa
ctgctccaggctttcttcctggtgtcggacgacatcatggactcctccctcacccggcgg
gggcaggtctgctggtatcagaagccaggcataggtctggatgccatcaatgacgcgttg
cttctggaagcatgtatctaccgcgtgctgaggctctactgccgggagcagccctattac
ctgaacctgattgagctcttcctgcagagttcctatcagactgagctcggacagacgctg
gacctcatcacggccccccagggcaatgtggatctcagcagattcactgaaaagaggtac
aagtccatcgtcaagtataagaccgctttctactcgttctatcttcctgtggctgccgcc
atgtacatggcgggcatcgatggggagaaggagcacgccagcgccaggaagatcctgctg
gagatgggggagttcttccaggtgcaggatgattaccttgatctctttggggaccccagt
gtgacaggcaagatcggcacggacatccaggacaacaaatgcagctggctggtggttcag
tgtctgcagcgggcctctccagagcagcgcaaggtccttcaggagaactatgggcaaaag
gaggccgagaaggtggcccgggtgaaggcgctctacgaggagctggagctgccggccgtg
ttcgggcagtaccaagaggacagctacggccgcctgatgggcctcatcgagcagcactct
gcgcccctgcccccggccatcttcctggggctggcgcacaagatctacaagaggaaaaag
tga

DBGET integrated database retrieval system