KEGG   Acinonyx jubatus (cheetah): 106981522Help
Entry
106981522         CDS       T04657                                 

Gene name
GBA
Definition
(RefSeq) glucosylceramidase isoform X1
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju00511  Other glycan degradation
aju00600  Sphingolipid metabolism
aju01100  Metabolic pathways
aju04142  Lysosome
Brite
KEGG Orthology (KO) [BR:aju00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    106981522 (GBA)
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    106981522 (GBA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    106981522 (GBA)
Enzymes [BR:aju01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     106981522 (GBA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C
Motif
Other DBs
NCBI-GeneID: 106981522
NCBI-ProteinID: XP_026904491
Position
Unknown
AA seq 574 aa AA seqDB search
MERSTPPREERPEPPGRGGVLAARLVGLLFLQAVPWASGARPCSPKSFGYSSVVCVCNAT
YCDSLDPLTLPAPGTFSRYESTRSGRRMELSLGPIRANRTGTGLLLTLQPDQKFQKVKGF
GGAMTDAAALNILALSPPARNSLLESYFSEEGIEYNIIRVPMASCDFSIRTYTYDDSPDD
FQLRDFILPEEDVRLKIPLIHQALELAPRPVSLFASPWTSPTWLKTNGAVNGKGSLKGQP
GDLYHQTWARYFVKFLDAYAEHKLRFWAVTAENEPSAGLFSGYPFQCLGFTPEHQRDFIA
RDLGPTLANSTHRDVRLLILDDQRLLLPRWAQVVLADPEAAKYVHGIAVHWYLDFLAPAK
ATLGETHRLFPDTMLFASEACVGSKFWEQSVRLGSWDRGMQYSHSIITNLLYHVVGWTDW
NLALNPEGGPNWVRNFVDSPIIVDITKDTFYKQPMFYHLGHFSKFIPEGSQRVGLLASEK
NGLDTVALMRPDGSAVLVVLNRFSLASPAPRRTCPSPSRTLLWASWRRCPPATPFTRTCG
VASDGADTQAAPGLGRGIKGTESAHTLSVATEDI
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atggagcgctcgactcctccccgagaggagcgccctgagcccccgggccggggaggcgtc
ttggctgccaggctcgtgggcctgcttttccttcaggcggtgccgtgggcctcaggtgcc
cgcccctgcagccctaaaagctttggctacagctcggtggtctgtgtctgcaatgccacg
tactgtgactctcttgaccccctgaccctgcccgcccccggcaccttcagccgatacgag
agcacacgcagcgggcgccggatggagctgagtctggggcccatccgggccaaccgcacg
ggcacagggctgctactgaccctgcagccagatcagaagttccagaaagtgaaggggttt
ggaggggccatgacggacgccgctgccctcaacatccttgccctgtcaccccctgcccgg
aattcgctactcgaatcctatttctctgaagaaggaatcgagtacaacatcatccgggta
cccatggccagctgtgacttctccatccgcacctacacctacgatgacagccctgacgac
ttccagttgcgtgacttcatcctccccgaggaagatgtcaggctcaagatacccctgatt
caccaggccctggagctggccccacgccctgtgtcactcttcgccagtccctggacgtca
cccacttggctgaagaccaacggggcagtgaacgggaaggggtcactcaaggggcagccg
ggagatctctaccaccagacctgggccagatactttgttaagttcctggacgcttacgcg
gagcacaagttacggttctgggcagtgacagcagagaacgagccttctgcagggctgttc
agtgggtaccccttccagtgcctgggcttcacccctgaacaccagcgagacttcatcgcc
cgggacctgggtcctaccctcgccaacagtacgcaccgcgacgtccgcctgctcatattg
gacgaccagcgcttgctgctgcctcgctgggcccaggtggtgctggcagacccagaggcg
gctaagtacgttcatggcattgctgtacattggtacctggactttctggctcctgcaaag
gccaccctgggggagacacaccgcctgttccccgataccatgctctttgcctcagaggcc
tgcgtgggctccaagttctgggagcagagtgtgcgactgggctcctgggaccgagggatg
cagtacagccacagcatcatcacgaaccttctctaccatgtggtcggctggacagactgg
aacctcgctctgaaccccgaagggggacccaactgggtgcgtaactttgtcgacagcccc
atcatcgtagacatcaccaaagacacgttttacaaacagcccatgttctatcaccttggc
cacttcagcaagttcattccggagggctcgcagagagtggggctgctggccagcgagaag
aacggcttggacacggtggcgctgatgcgccccgacggctctgcggtcctggtcgtgctg
aaccgcttctcccttgcttccccagctccccgaaggacgtgcccctcaccatcgaggacc
ctgctgtgggcttcatggagacgctgtcccccggctactccattcacacgtacctgtggc
gtcgccagtgatggggcagatacccaagcagcgcctgggctcggcaggggcattaaaggg
acagagtcggctcacacgctgtctgtggctacagaggatatatga

DBGET integrated database retrieval system