KEGG   Acinonyx jubatus (cheetah): 106981574
Entry
106981574         CDS       T04657                                 

Gene name
APLN
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04080  Neuroactive ligand-receptor interaction
aju04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    106981574 (APLN)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    106981574 (APLN)
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 106981574
NCBI-ProteinID: XP_026910052
Position
Unknown
AA seq 77 aa
MNLRRCVQALLLLWLSLTAACGGPLLQPSDGNGLEESNVRHLVQPRGSRNGPGPWQGGRR
KFRRQRPRLSHKGPMPF
NT seq 234 nt   +upstreamnt  +downstreamnt
atgaatctgcggcggtgcgtgcaggcgctcctgctgctctggctctccctgaccgcggcg
tgtggagggcccctgctgcagccttctgatgggaatgggctggaggaaagcaatgtccgc
cacctggtgcagcccagagggtcgaggaacggaccagggccatggcagggaggtcggagg
aaattccgccgccagcggccgcgcctctcccacaagggccccatgcctttctga

DBGET integrated database retrieval system